CAZyme Information: MGYG000001668_00679

Basic Information

• Species: UBA1259 sp900760875
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA1259; UBA1259 sp900760875
• CAZyme ID: MGYG000001668_00679
• CAZy Family: GH4
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000001668_56|CGC1	41970.1	6.1149

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001668	1885348	MAG	United States	North America

• Gene Location: Start: 7770; End: 8870 Strand: -

Full Sequence      

MRNADFVVNAIQVGGYKPCTVTDFEIPKKYGLRQTIGDTLGIGGIFRALRTLPVMEEFAD
DMSRVCPRAYFLNYVNPMAILTGYMQKYTNIKTVGLCHSVQVCVPWLFDSIGMSDKIQES
GYKIAGINHQAWLLEIYDKNGKDLYPEIKKRAKEEKYRTGSAKNDLVRFEIMDRFGYYNT
ESSEHTAEYSPYFIKNRYPELIERFNIPLDEYPRRCVNQIADWEKQRKELVGNERIEHIK
SREYAADIIKAMVTDNPYKINGNVLNDGLIDNLPKEACVEVPCLIDRSGISPCHIGNLPE
QLAALNRTNINVQLMVLAAYRTKKKEDVYMAAYLDPHTSAELSMDEIKALCDELIEAHGN
WLPELH

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	2	104	2.3e-41	0.5586592178770949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15076	PRK15076	0.0	2	366	74	431	alpha-galactosidase; Provisional
cd05297	GH4_alpha_glucosidase_galactosidase	1.09e-164	2	355	73	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	2.33e-138	2	366	76	440	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
pfam11975	Glyco_hydro_4C	6.43e-61	124	338	1	168	Family 4 glycosyl hydrolase C-terminal domain.
cd05296	GH4_P_beta_glucosidase	9.71e-50	2	362	74	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU16138.1	3.34e-187	1	364	73	438
ANU78021.1	3.34e-187	1	364	73	438
ASU30829.1	3.34e-187	1	364	73	438
QQQ91358.1	3.34e-187	1	364	73	438
QBE95675.1	6.72e-187	1	364	73	438

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	3.40e-27	4	336	76	419	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
6DUX_A	2.85e-26	3	366	80	443	ChainA, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DUX_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_A Chain A, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae]
1U8X_X	6.98e-24	3	365	102	464	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
5C3M_A	2.00e-23	1	364	78	436	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	4.99e-21	1	364	81	439	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34645	1.22e-169	1	364	73	430	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
P06720	2.19e-122	1	363	76	446	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1
P30877	7.08e-121	1	363	76	446	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2
Q9X4Y0	5.23e-54	1	364	75	441	Alpha-galactosidase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=melA PE=3 SV=1
D3T426	1.94e-40	1	362	77	450	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001668_00679.