CAZyme Information: MGYG000001669_00284

Basic Information

• Species: UBA7642 sp900539865
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-288; UBA7642; UBA7642 sp900539865
• CAZyme ID: MGYG000001669_00284
• CAZy Family: GH39
• CAZyme Description: Beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513		59334.76	6.6173

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001669	1366807	MAG	United States	North America

• Gene Location: Start: 292626; End: 294167 Strand: +

Full Sequence      

MKIDIDINASRKKTDYSWQEGLGADHACQFHRSDMVEQLKFAHDELGIKSLRFHGIFDDD
MWTISDLCTFSPMPGGHQVGDINFRQCGHVYDNLLSAGVKPFVELSFMPTQLAKKKTYGL
HYKNCTSIPKSYEMWNDYIQSFVKFLLNRYGQEEVESWKFEVWNEPDLKGFFHNKQKDYF
KLYEVTARAIKSVDDRIQVGGPSTSACKWIDEFLQFCKSNKVPLDFISTHHYPGDAFGNM
ITPANYFAIFKTMNKAVKNKSDLTETLGKMFFYPDKAARVTKDALTKMDDELVKKVGDLP
VYISEWNSMAIFAAPIHDEKYSAAFVTKSVLDLNNKFQGYMFWCLSDLFEEQIQLNKPFI
GGFGILTNDGIPKPNFWAFKLLSKLYEERLNIGFREFKEVEYGVFKKENSLQILLTPQNN
DPRLNDVHQIEISINSNIKSVSIERIDDDHCNPKQEWIALGKPNNLSKQQVLYIKEKTRL
KRELLSFENQNDTGLVSLKMHTNDVALLTIELE

Enzyme Prediction     

No EC number prediction in MGYG000001669_00284.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	13	466	1.5e-111	0.988399071925754

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	4.82e-97	1	512	1	487	Glycosyl hydrolases family 39.
COG3664	XynB	1.58e-40	32	513	3	425	Beta-xylosidase [Carbohydrate transport and metabolism].
pfam11790	Glyco_hydro_cc	0.005	122	247	27	156	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYN52652.1	2.44e-108	3	510	2	483
QYN58460.1	6.87e-108	3	510	2	483
AWM75154.1	2.81e-107	2	510	3	485
QPC92966.1	5.51e-107	6	487	8	452
QYN52656.1	1.71e-105	18	510	18	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PX8_A	5.36e-69	10	512	10	479	Crystalstructure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1PX8_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_A Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_C Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_D Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum]
4M29_A	1.62e-66	3	511	11	497	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	2.27e-66	3	511	11	497	ChainA, Beta-xylosidase [Caulobacter vibrioides]
1W91_A	2.66e-64	11	511	11	481	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	7.26e-64	11	511	11	481	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23552	1.12e-97	1	511	7	486	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
P36906	4.11e-68	10	512	10	479	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
O30360	6.36e-66	10	512	10	479	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
Q9ZFM2	2.16e-62	1	511	1	482	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
T2KM23	6.55e-11	129	233	163	270	Alpha-1,4-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22200 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001669_00284.