CAZyme Information: MGYG000001669_00862

Basic Information

• Species: UBA7642 sp900539865
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-288; UBA7642; UBA7642 sp900539865
• CAZyme ID: MGYG000001669_00862
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578	MGYG000001669_3|CGC4	65710.47	9.034

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001669	1366807	MAG	United States	North America

• Gene Location: Start: 248359; End: 250095 Strand: +

Full Sequence      

MKKSSYLYKLILAIWLCCFSGLMFLLYRSIASVVTGSEFFTVREGFIIFFLILNFFALGF
MWLGSIKDLMFSLYYVIHRKKIMKKYDAINKIEVKDTPRILLVYCTCNDFNSSALSECMK
QDYSNVKTVILDDSSKEEYLKEIDEFAMKNSLEVVRRVDKTGFKAGNLNNYLKNHHDYDY
FVVLDSDEVLPRDYCKKILKYFYYNKKIGAVQACHVASQGENAFQSLMGLSVKSNGQTCQ
VVKNFYGSNALIGHGMTISRACYEKTGGFPLVVAEDISFAIDIKNNGYEIVYAPDIICEE
EFPIDYLCLKKRQCKWTQGNVEFIKKYDKSLRDSKMSWFEKLDVKLSHYSLPIVPVLSNI
VVFSVIALGFLGYKGAIYSYLMIGLMTLFLIAPLIPDLFVWGKTKMSLKLIPYFLLNLIT
YASLSPMMIKTIFLGLFGKKAKFIITPKTAKEISIKEAFTASLDSLLFGVLIIVLGYFST
GTIVPFLFIILGCLGAPFAILSANIHVHKKTQTEPKIRRSFKNATFSSRPLQAKTKVVLN
TKFALTYEDASCQTYSLVADAPESNEFILVGDMMYAFC

Enzyme Prediction     

No EC number prediction in MGYG000001669_00862.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	112	306	8.5e-22	0.8652173913043478

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	3.93e-25	98	322	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	3.45e-24	41	494	5	413	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	7.71e-18	118	276	19	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	4.53e-16	98	319	1	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06437	CESA_CaSu_A2	6.63e-16	130	319	37	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABC01535.1	4.34e-172	1	521	1	524
QDL20008.1	4.34e-172	1	521	1	524
QDL19322.1	4.34e-172	1	521	1	524
QIN44161.1	4.34e-172	1	521	1	524
QIN44840.1	4.34e-172	1	521	1	524

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8LIY0	1.14e-14	98	344	233	493	Probable xyloglucan glycosyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC1 PE=3 SV=1
Q6L538	1.99e-14	96	344	228	490	Probable xyloglucan glycosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC7 PE=2 SV=1
P19449	1.39e-06	126	292	182	349	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
45	64
349	371
378	400
415	437
458	480
485	507