CAZyme Information: MGYG000001671_00470

Basic Information

• Species: HGM11507 sp900761005
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1840; UMGS1840; HGM11507; HGM11507 sp900761005
• CAZyme ID: MGYG000001671_00470
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000001671_8|CGC1	47804.5	7.1855

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001671	3303038	MAG	United States	North America

• Gene Location: Start: 30660; End: 31880 Strand: -

Full Sequence      

MNIGFVSTWLERGAAYVTRTYMRLLEDRHSLFVYARGGEYIDRNLDSSDVTYGLRLKGTE
IDWHHFSNWIQKKNLDIIFFNEQSDFLCLYQIKKYFPQLKIGAYIDYYKEDTVKEFAIYD
FLICNTKRHYSVFSWHPGAFYVPWGTDLELFSTKQNRKPDDTVVFFHSMGMSPRKGTDCL
ISAYINGEFYHKNAKLLIHTQVSMDHLLSKDEAEKYNIDIIEKTVSAPGLYHLADVYVYP
ATLDGLGLTMYEALACGLPVIATNTAPMNEIITDVNGKLVSVEQYRTRKDAYYWPLAIVD
ESSLITAMQFYIDHASELPYLKENARQYAEEHLNVWDRKKEIQKIFEKIYEEPSQEGDYT
ALLKTYQSNRRKEFLRLFAEICFPNRLKHHIRQNREKKRNYGIKIH

Enzyme Prediction     

No EC number prediction in MGYG000001671_00470.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	154	285	1.7e-17	0.85

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.98e-22	2	351	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03825	GT4_WcaC-like	1.97e-18	140	352	164	363	putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.
COG0438	RfaB	4.62e-18	119	352	151	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03800	GT4_sucrose_synthase	4.64e-15	94	338	147	391	sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.
pfam00534	Glycos_transf_1	1.12e-13	172	280	12	126	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANV77788.1	2.92e-184	1	399	1	402
ABN53540.1	2.92e-184	1	399	1	402
ALX10014.1	2.92e-184	1	399	1	402
ADU75979.1	2.92e-184	1	399	1	402
BCS80366.1	2.92e-139	1	347	1	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OKA_A	3.66e-07	127	280	153	326	Crystalstructure of Corynebacterium glutamicum PimB' in complex with GDP-Man (triclinic crystal form) [Corynebacterium glutamicum],3OKA_B Crystal structure of Corynebacterium glutamicum PimB' in complex with GDP-Man (triclinic crystal form) [Corynebacterium glutamicum]
3OKC_A	3.78e-07	127	280	153	326	Crystalstructure of Corynebacterium glutamicum PimB' bound to GDP (orthorhombic crystal form) [Corynebacterium glutamicum],3OKP_A Crystal structure of Corynebacterium glutamicum PimB' bound to GDP-Man (orthorhombic crystal form) [Corynebacterium glutamicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8NNK8	2.00e-06	127	280	153	326	GDP-mannose-dependent monoacylated alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pimB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001671_00470.