CAZyme Information: MGYG000001671_00801

Basic Information

• Species: HGM11507 sp900761005
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1840; UMGS1840; HGM11507; HGM11507 sp900761005
• CAZyme ID: MGYG000001671_00801
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1022		117000.31	8.9187

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001671	3303038	MAG	United States	North America

• Gene Location: Start: 20825; End: 23893 Strand: +

Full Sequence      

MSYFYLSLILSFFFLFFCWYTYRKERELSAANKMSYMAIIIGAGLCIRFVFGFSSKGYGT
DMSCFASWSYHIFENGFREFYDSISFCDYPPGYLYILYILGFLTRIFDLSYQSAGANFLL
KLPAVLCDIGLIVMACRFAKREKASGILLALLLAFSPALIMTSAVWGQVDSVLCVLLLLC
FLYGTKGKLEWSALFFTLAALVKPQAFLFTPLVMILFAYHDKVMFGFCKKKLSKVSTVFW
NYLITLLFSGSIFYILSVPFFGFNCLPGLIEKYYSTLSSYAYASVNALNLNFLSGGNWAE
LDTPFLFLTYGTWSTLLLTAIVIVSVWLFIRTKEKKAVFLTSGIFLLSVYTLTAKMHERY
FFFCVLLFAFAYAVHKRKELFILFGGISVTYFLNLVLAYIDQVNHIPKDSGWGMILSAVH
IAFLVLSYLTYFRIYPLRKRDSMKETTPFLKEKKTKKIQKIDYIIMAVITLIYGVLAFVN
LGDTASPQTSIALKQGDIVTFTLSPGNYDAMMVFEGMDLGDIVIHGSTDGVNYEKISDFE
KRSVFSWKRFELEQDYQKIRLTVEKTDNAFIELLETGFLDAGTRKPVMPLSVTVNGRSVT
ELSDEQNLVPSYPTCQNGTYFDEIYHARTAYEFNHDLTIYENTHPQLGKLIMALGVKLFG
MTPFGYRCMGTLLGVLMLPILYLFIKRMFRSTFLSTVGTLLFAVDFMHFTQTRIATIDVF
IVFFILLMYYFMYQFYEQSKEAVNLKKYVLYLFLSGLMFALGISSKWTGAYAGVGLALIY
AISIYNIWKQAKEENKNFGKILAVLLSCGVGFFVLIPVAVYFIVYIPYFICMKDPINLDS
FMRINTHMFNYHSKLNDTHPFASKWYEWILDLKPIWYYQSLNPYAEGIKGTIAAFGNPLV
WIGGFAAVLYMLKDTIKKKNGIGLFLFIAYIVQILPWIPVAEARTTFIYHYFPAVPFLIM
GICYVFDIYLKRYKNAKESVIAICAFTATAVLLFFVYYPVLSGLECSTGYINALKTLPTW
IF

Enzyme Prediction     

No EC number prediction in MGYG000001671_00801.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	617	829	1.5e-53	0.9192825112107623

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	7.44e-23	841	998	3	177	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	5.55e-19	621	842	50	281	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	1.39e-17	838	1022	498	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	1.16e-14	617	829	19	241	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	1.27e-12	644	821	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASA25569.1	1.15e-189	6	1022	219	1268
CQR52353.1	2.05e-183	6	1022	223	1275
AIQ66842.1	2.81e-181	36	1022	11	1031
QSF45552.1	6.11e-181	36	1022	254	1273
AIQ15817.1	3.05e-180	36	1022	11	1031

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	2.36e-23	621	1020	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	2.36e-23	621	1020	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	2.23e-22	613	1020	59	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	1.32e-15	644	1020	99	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000010	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	22
35	52
90	107
144	166
195	217
238	260
308	330
337	354
359	374
381	400
410	432
463	485
663	685
692	709
714	736
748	765
769	788
801	823
890	912
921	943
947	966
979	1001