CAZyme Information: MGYG000001671_01291

Basic Information

• Species: HGM11507 sp900761005
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1840; UMGS1840; HGM11507; HGM11507 sp900761005
• CAZyme ID: MGYG000001671_01291
• CAZy Family: PL21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1272		141888.52	4.4248

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001671	3303038	MAG	United States	North America

• Gene Location: Start: 32; End: 3850 Strand: -

Full Sequence      

MLKKVLGTILACSFLFSCFPAPPASAADGPFSDWTEIKGLGNLNNSDLYWETEDTAEGLT
INKGYFTNMTYGSNITQMPTFRWCVGGTPEGYPDSDFTANPQLVEIAEEEGEKAVHIDSP
VNGYGITLQFPVLEFDGTYTKDHYYKITYKAKKKDGGIVEGGNNRFFTMVDFKDSANKRL
STTRSVFVNPSDSFQEYEMYVANIPETATKMTVFFALSAASAVRDVYIADVKVYVKDGSK
PLVLYDMPAFTPPANQHPRVYFTKQDIPNILANYDHPQNANAKAQFEEDLSKPVDGNLSG
GMLNSATLGLIQSRAFHYAVWGNRESGEMAVKAMRDFVNTVNYAASEYNNQGFLIFTIGA
VYDWCFPLLSEEDKTFFQNKAEDVMRVWEVGYPVPAQSVINTHSAEAMLMRDQLALAIAM
YDERPDIYQNIGGRYFAEMVEARKFMAQAQIFVQSSCYMGMRFQWEILSSIMMDKIGMPN
VFGEDLHKVLYGFLYARRADGQLLRWGDSDQNNTKPGVYDTDATRALFLAGNYYKDPYLK
GQALLQNPGIQVSPTSGNQTMTSIEVLLFNDPSVEGKAVSDLPLSAYYPSPRGGMIARTG
WQDGIDSPAVVADMKVNEYWTMNHQHLDAGSFQIYYKGALANDTGYYQAGRSGDPKKNEG
NTVYGTVHFHNYARRTIAHNCMLVYDPDELDMYFNGYVNDGGQRLPNNDCYPMNIEEYLE
LEKEYRTGTVLGQEFGPDPYVPDYTYLKGDIAAAYSDKVSAYERSFQFLNLKDEEHPAAM
LVFDRVVSSDPTFKKSWLLHGLEEPEITGNQTVFRDTREGYNGKLTVDTLLPLPDNTSIE
TVGGEGKEFLVNGTNYWAETLQGGVNEGGGYRIEVSPKKAAAEDYFLNVLQVGDNEPDTP
PLEVTKLETETFVGAKLADRVALFGKFRDRTAESMDFSFEGEGRYQITVADLQCGTWAVQ
RNGETLAEVFATQEGGIVSFEGEAGDYRLTYAGACGSREELSGQPPQQDEGIHIRVNNRL
IYSDVAPVTINDRTMVPMRAVFQNLQAEVEWDEATMSATAVKENTTIRITDGSETAYVNG
EAVTLDSPAVIRDGRFLVPVRFVSESFGARVVWEEFSKTVDITYNAGISEENYHNITGWL
PVAAMEQSGDDGAGNVIEQTRDGAFSTSWGVQGVEGSDSAWGIYDFGQIREIEKVMIAFI
KGTERIYTFTLQTSEDGKSWKTVLDQAKSSGTSNQFETFAFDKTKARYMKYIGYGNSVNL
WSNISEIVFIGK

Enzyme Prediction     

No EC number prediction in MGYG000001671_01291.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL21	609	688	2.3e-26	0.9583333333333334
CBM32	1147	1267	2e-16	0.9193548387096774

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	9.68e-33	1030	1122	1	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam18675	HepII_C	5.02e-15	907	990	2	87	Heparinase II C-terminal domain. Heparinase II (HepII) is an 85-kDa dimeric enzyme that depolymerizes both heparin and heparan sulfate glycosaminoglycans. The protein is composed of three domains: an N-terminal alpha-helical domain, a central two-layered beta-sheet domain, and a C-terminal domain forming a two-layered beta-sheet. The C-terminal domain contains nine beta-strands packed together in a manner resembling a beta-barrel.
pfam00754	F5_F8_type_C	1.45e-09	1162	1267	19	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam07833	Cu_amine_oxidN1	1.82e-09	1014	1055	47	88	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
PRK14696	tynA	6.35e-09	1035	1107	1	73	primary-amine oxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH20141.1	9.70e-178	136	1255	128	1207
QHW00380.1	7.07e-161	252	990	67	799
ACU04612.1	5.54e-156	253	989	44	770
ABJ17170.1	1.09e-155	253	989	44	770
AAB18277.1	1.09e-155	253	989	44	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2FUQ_A	9.61e-158	253	989	19	745	ChainA, heparinase II protein [Pedobacter heparinus],2FUQ_B Chain B, heparinase II protein [Pedobacter heparinus]
3E80_A	1.02e-157	253	989	21	747	Structureof Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_B Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_C Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus]
3E7J_A	6.12e-155	253	989	21	747	ChainA, Heparinase II protein [Pedobacter heparinus],3E7J_B Chain B, Heparinase II protein [Pedobacter heparinus]
2FUT_A	9.66e-152	253	989	20	746	ChainA, heparinase II protein [Pedobacter heparinus],2FUT_B Chain B, heparinase II protein [Pedobacter heparinus]
5ZU6_A	9.67e-19	1141	1270	34	157	ACBM32 derived from alginate lyase B (AlyB-OU02) [Vibrio]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6XZB6	1.11e-156	253	989	44	770	Heparin and heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepB PE=1 SV=1
P80695	2.35e-06	1035	1107	34	106	Primary amine oxidase OS=Klebsiella oxytoca (strain ATCC 8724 / DSM 4798 / JCM 20051 / NBRC 3318 / NRRL B-199 / KCTC 1686 / BUCSAV 143 / CCM 1901) OX=1006551 GN=maoA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000597	0.706017	0.292475	0.000347	0.000296	0.000244

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001671_01291.