CAZyme Information: MGYG000001671_02840

Basic Information

• Species: HGM11507 sp900761005
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1840; UMGS1840; HGM11507; HGM11507 sp900761005
• CAZyme ID: MGYG000001671_02840
• CAZy Family: PL21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1041		116603.21	4.7901

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001671	3303038	MAG	United States	North America

• Gene Location: Start: 51; End: 3176 Strand: -

Full Sequence      

MKKNKKLISLTILFSMCLSFLLFPFTASASLTSKWNSPPFYPEKGAHPRVLINQADIPVI
KANLTKPQNQNAYKKFQELLTQDTTGGFPDEKEAGKGNISANVQLLTAIEAKAFDYVING
NEQSGADAVASIKNAIKTIKYPTVGDYSRDSGMVLYVISIVYDWCYPLLSDKDKTQFIAD
GQTASANMEVGWPPERFGAVIGHGAEAQFLKELIAFAIATYDESPDIYEYVAGRFFDEYV
PARNYWYKSHSLHQGSGYNTVRYAFDLWAQWLMYKISGQRVFVDDCQYVSYQCLYYTRPD
EQIFREGDYSSESLGRIPSANSYAMRMGFLASGFYKDPYLKMELARLSDQYSKFENSFQW
LTPVTFLIMNDPDLEPKSYKDLPNTKYFGEPNGLMMARTGWDLGVESPVAIAMMKIGGLW
MANHNHLDNGTFQIYYKGNLANDSGLYTTYGVSHDVNWHKETIAHNGLLIYDPSEVPSGG
AVNSGGQRRPGGEQVTIDGYLENDYKMAQVIGHEFGPDPYQPEYSYISGDITKSYTDKVS
EVTRSMMFMPNENKDAPAVFFVMDKIAAKKANFKKTFLLHSLQEPEVNGNVTTIKRDTDG
YNGKLTVQTLYPQNPTIEKIGGEGKQWYINGTNYVPSKGTAETMNKDLSSGWGRVEISPT
EKQKTDYFLNAMYVSDADGKTEVIPAELIETDELLGAKLDQKVTMFNKEQKRIAGNTSFT
VPDSGTYDIAVCGLEKGEWSILLNGKEIGTQIASEEGGMIYFSGEAGNYTLRMKDASKVK
ETPQVEPVEHENISIKIGKNYLYSDVPATIKDDRTLVPMRAIFEKFGAEVEWEDATQTAT
ATRKGKTIRLTEGSQTVYVDDQPVTLDVPAQIVDGRFLVPVRFIAETFGSTVTWDDFAKI
VNISEPKDMGASNKIPVVNVTWSSATADDKGGYNAVDGDLDTRWAANGIGENLTLEFDGV
KKISSFSTAFNDPISRGYFFELEYSVDGKTFTKFFEGKSSQKQDIDTFKLDQPINAKYIR
YIGKGGTYTDYILLQEIEFYE

Enzyme Prediction     

No EC number prediction in MGYG000001671_02840.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL21	411	473	1.4e-22	0.9166666666666666
CBM32	923	1026	6.5e-19	0.8064516129032258

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	1.23e-34	811	903	1	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam00754	F5_F8_type_C	1.01e-13	919	1037	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
PRK14696	tynA	1.47e-10	816	890	1	75	primary-amine oxidase.
pfam07833	Cu_amine_oxidN1	6.34e-10	793	838	38	90	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam18675	HepII_C	7.13e-10	688	771	1	86	Heparinase II C-terminal domain. Heparinase II (HepII) is an 85-kDa dimeric enzyme that depolymerizes both heparin and heparan sulfate glycosaminoglycans. The protein is composed of three domains: an N-terminal alpha-helical domain, a central two-layered beta-sheet domain, and a C-terminal domain forming a two-layered beta-sheet. The C-terminal domain contains nine beta-strands packed together in a manner resembling a beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63941.1	3.40e-190	47	773	43	791
BBH20141.1	4.86e-185	31	1025	224	1207
BCI63940.1	4.36e-183	47	779	47	799
QOU74174.1	2.72e-139	38	777	182	943
AYM77060.1	7.44e-139	38	777	182	943

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2FUQ_A	6.36e-139	47	769	23	743	ChainA, heparinase II protein [Pedobacter heparinus],2FUQ_B Chain B, heparinase II protein [Pedobacter heparinus]
3E80_A	6.73e-139	47	769	25	745	Structureof Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_B Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_C Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus]
3E7J_A	4.09e-136	47	769	25	745	ChainA, Heparinase II protein [Pedobacter heparinus],3E7J_B Chain B, Heparinase II protein [Pedobacter heparinus]
2FUT_A	6.23e-134	47	769	24	744	ChainA, heparinase II protein [Pedobacter heparinus],2FUT_B Chain B, heparinase II protein [Pedobacter heparinus]
5ZU6_A	2.74e-12	920	1027	35	144	ACBM32 derived from alginate lyase B (AlyB-OU02) [Vibrio]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6XZB6	7.03e-138	47	769	48	768	Heparin and heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepB PE=1 SV=1
P46883	2.41e-06	816	890	37	111	Primary amine oxidase OS=Escherichia coli (strain K12) OX=83333 GN=tynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000365	0.998880	0.000234	0.000180	0.000159	0.000152

TMHMM  Annotations     

start	end
7	29