CAZyme Information: MGYG000001672_00500

Basic Information

• Species: UMGS995 sp900547465
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UMGS995; UMGS995 sp900547465
• CAZyme ID: MGYG000001672_00500
• CAZy Family: GT8
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572	MGYG000001672_6|CGC2	68412.33	6.0678

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001672	1285890	MAG	United States	North America

• Gene Location: Start: 34569; End: 36287 Strand: -

Full Sequence      

MQTYVCVLSTDNYLDGVLVLNENLKFLGSKYPLLCLINENISRSTIETLDYFDIKYKIIK
KINYINHNEANDYWIYTFDKLNVFSLTDYEKVVYLDSDLLILENLDHLFECPTPSMSLDL
PWYNDRYNTGIMVITPNIYDYNRLKCDALKSDVLKRQISDQDIINEYFDNITPLSFGYNM
VRRITEDEESCDFFDYIGSYSHKMPQCNLYLKESKYAKVIHYIGKRKPFMLYNDFGDKYS
KLYFFYLENVRKKKFEFTLDKKLISVIIPIYNKEKYLRKCLDSVTKQTYKNLEIILINDA
SKDNSLKICKEYAMNDKRIKLLTNKRNKGVSYSRNKGLEIATGDYISFIDADDKIEKSMY
ELLISDIVRSDVDFVQCRMILNGQHEWRPEGVFYGNYSVIEQFLNDTISLSCCDKLFKFS
CIKQKKFREDVYKNEDAMFIFDIIKDCNSIMFSDKYLYNYIYKKEDSLTGDYDFDKDRSI
IEHTTMVYEYIKKYYRGMLDKIVYKWYKTYCYVYQNITKNIDNVRKTDIIELNNSILNFR
NNNKKNLEESQVEYLDRILDFFKSYVNLSEGD

Enzyme Prediction     

No EC number prediction in MGYG000001672_00500.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	265	392	7e-38	0.7529411764705882
GT8	2	229	2.3e-34	0.8715953307392996

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02537	GT8_Glycogenin	2.70e-39	4	248	3	231	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
pfam00535	Glycos_transf_2	4.05e-36	265	413	1	152	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
PRK10073	PRK10073	1.76e-33	263	387	7	133	putative glycosyl transferase; Provisional
cd00761	Glyco_tranf_GTA_type	1.43e-32	266	381	1	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04184	GT2_RfbC_Mx_like	1.45e-27	263	376	2	125	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAK43610.1	5.24e-37	264	528	14	280
CCG97594.1	1.68e-36	264	528	14	280
SQF30767.1	1.68e-36	264	528	14	280
QBG80605.1	1.68e-36	264	528	14	280
QBG80623.1	1.68e-36	264	528	14	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.21e-26	262	465	5	220	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	1.81e-22	264	460	7	224	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
3USQ_A	2.42e-14	2	228	24	239	Structureof D159S/Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
3USR_A	3.25e-14	2	228	24	239	Structureof Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
3Q4S_A	7.36e-14	2	228	5	220	CrystalStructure of Human Glycogenin-1 (GYG1), apo form [Homo sapiens],3QVB_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP [Homo sapiens],3U2W_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens],3U2W_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2UR96	7.23e-24	262	482	3	236	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
A0A0H2URH7	9.21e-22	264	464	7	219	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
P11290	8.37e-21	264	377	8	120	Uncharacterized glycosyltransferase YibD OS=Escherichia coli (strain K12) OX=83333 GN=yibD PE=3 SV=2
P71059	5.87e-18	263	377	4	117	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
H2KYQ5	7.33e-18	2	228	3	218	Glycogenin-1 OS=Caenorhabditis elegans OX=6239 GN=gyg-1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001672_00500.