CAZyme Information: MGYG000001673_00125

Basic Information

• Species: UMGS1537 sp900552695
• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212; UBA1255; UMGS1537; UMGS1537 sp900552695
• CAZyme ID: MGYG000001673_00125
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842		95299.04	5.7551

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001673	2567696	MAG	United States	North America

• Gene Location: Start: 3097; End: 5625 Strand: -

Full Sequence      

MFRPDKIRIDYGALRGDARCRISTTSAPVLQWSVLPDETAKVQSAYRIQVTASGHLLWDT
GWTESAEQFVRYQGNALPVGERIEIEIRIKDQVGRESLPANDFFYFGQVADWKAAWIASS
EDIHRKTVYFCNDFILEREPEDAYLLICGLGYHKVFLNETPLDSSLLDPAYSDYTKTCYY
AMIPELASHLSKGRNTIRCAVGEGWRRLDSSFIQKHLGMRRMRFEGTPQLSAILFVKIEG
TWSRCITTDSSWNWTSGPLVSNNLYDGIVYDARLPFSPQKQVRLVPAPGGKMCVQSLEPI
RKKEAWRPLSVLLLRNDTYLVDFGQNTAGFAALRLPSHTESGQKITVAYAELLNENGDLF
TEPLREAKATDTYICSGEEAGKPIWEPDFTYHGFRYIRVSGYGEPLTAEDLTAYSIYTDI
EKAQNYFTCGSALVNQIHRNAVLCEKSNLHSIMADCPQRDERMGWMNDATVRFEATPFNF
EIGRLFPKVIRDILDVQDPDGSITCTAPFVIGARPADPVCSSFLIAGLEALLHTGNTEII
REAYEGFRAWEDCLLAHSEAYIVNYSYYGDWAAPAYACEGEDGAVSAVTPGILMSTGYSY
YNCTLLEKFARLLGKEEDVNYYYELSGKIRAAFLQKWFNPESGKIATGSQACQVFPLWLG
LIPDESTTSAVNVLIQDLLRRDYQITTGNLCTRYLFDVLAKYGHIDDAWEIITREDYPSF
GYMIQNEATTIWERFELKKNPGMNSHNHPMYGAVDYWFYAYLCGIHPDSPGWKTFTVRPY
FPRKLLSAHAQVETPLGTVTVKWLKQYGKTQLYVAVPFGATARVDFNGKVKTVTCGFHHF
SS

Enzyme Prediction     

No EC number prediction in MGYG000001673_00125.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	315	824	2.6e-143	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.50e-91	426	762	5	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	3.88e-32	314	417	3	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	7.91e-29	139	304	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	1.18e-14	764	824	1	61	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22854.1	2.37e-184	19	824	38	849
VEH16339.1	5.33e-176	27	841	51	869
QEC51112.1	3.77e-168	43	824	105	893
AEF82974.1	2.97e-158	57	824	65	839
AHF90970.1	4.26e-154	25	824	24	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.58e-144	17	824	34	896	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	3.03e-92	28	836	23	848	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	8.20e-83	143	824	319	992	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	2.27e-89	28	825	55	877	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.99e-88	26	822	49	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	1.55e-85	25	827	48	907	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	3.82e-82	143	824	319	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KM26	1.77e-09	315	829	603	1142	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001673_00125.