CAZyme Information: MGYG000001673_00547

Basic Information

• Species: UMGS1537 sp900552695
• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212; UBA1255; UMGS1537; UMGS1537 sp900552695
• CAZyme ID: MGYG000001673_00547
• CAZy Family: GH163
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616		69780.91	4.7762

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001673	2567696	MAG	United States	North America

• Gene Location: Start: 13282; End: 15132 Strand: -

Full Sequence      

MRLKLECKSALIYLFIVIGVVAMCACDRVKERQYYEIPAAESANCTNLIWEGKSNYAIIY
GKDAAASEKTAAKELQKYLKKISGVELWLSDDASEQEGVWEILIGKTNREANGLYTVDRA
ELGKDGFEIKWADRKLVIAGGEARGTLYGVYDFLEQLGCRFFSTDTEVVPKRKTLTLDIT
QTVKEKPAFEYRDLFWTCSFDEVISAKMRLNGSVISGENGRMISDAYGNGLEYAGEHFVH
TFHSLVPAETYFAEHPEYFSEINGKRTSEYLYSQLCLTNPDVLQITIEKVKEWLRANPNA
KIVSVSQDDSFVIESYCTCEECNQVNKEEGSKSGTLIRFVNAVADAIKDEFPDVAVDTLA
YQYSVEPPRKTVPRENVIVRVCTGVCSAHAIGSCATSDGIKNNIKRWARISDRIYVWDYT
TDFAEYLCPFPNLNSLQGTIQFFAKNNVKGVFEQGNYQKGKSGEFGELRAYLLAKLLWDP
DTDIETHMQEFLDAYYGKASDSVKAYLDYIHKIIADSGKCFNLVVQASALFEGLIPDEDL
NMLDELWKNAEAAVEKRELDHVRRSELQYRWYKMKSLRGEFADSSRFGELENEFYADCNA
LGVLRMNEGANVPWVS

Enzyme Prediction     

No EC number prediction in MGYG000001673_00547.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH163	245	507	1.6e-93	0.9960159362549801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16126	DUF4838	2.51e-112	238	507	1	263	Domain of unknown function (DUF4838). This family consists of several uncharacterized proteins found in various Bacteroides and Chloroflexus species. The function of this family is unknown.
pfam03648	Glyco_hydro_67N	7.13e-08	59	152	24	119	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
cd11288	gelsolin_S5_like	0.008	60	108	46	92	Gelsolin sub-domain 5-like domain found in gelsolin, severin, villin, and related proteins. Gelsolin repeats occur in gelsolin, severin, villin, advillin, villidin, supervillin, flightless, quail, fragmin, and other proteins, usually in several copies. They co-occur with villin headpiece domains, leucine-rich repeats, and several other domains. These gelsolin-related actin binding proteins (GRABPs) play regulatory roles in the assembly and disassembly of actin filaments; they are involved in F-actin capping, uncapping, severing, or the nucleation of actin filaments. Severing of actin filaments is Ca2+ dependent. Villins are also linked to generating bundles of F-actin with uniform filament polarity, which is most likely mediated by their extra villin headpiece domain. Many family members have also adopted functions in the nucleus, including the regulation of transcription. Supervillin, gelsolin, and flightless I are involved in intracellular signaling via nuclear hormone receptors. The gelsolin-like domain is distantly related to the actin depolymerizing domains found in cofilin and similar proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOY90686.1	4.15e-116	39	572	10	528
ASV73444.1	6.92e-107	52	554	32	522
AIF26900.1	8.96e-107	52	500	10	468
AIE83908.1	4.61e-105	57	508	22	452
QQL44163.1	9.49e-104	54	554	19	508

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000193	0.052039	0.947705	0.000021	0.000034	0.000024

TMHMM  Annotations     

start	end
9	26