CAZyme Information: MGYG000001673_00993

Basic Information

• Species: UMGS1537 sp900552695
• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212; UBA1255; UMGS1537; UMGS1537 sp900552695
• CAZyme ID: MGYG000001673_00993
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467		54112.76	9.5374

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001673	2567696	MAG	United States	North America

• Gene Location: Start: 48632; End: 50035 Strand: -

Full Sequence      

MMDAFKLFFDYVGVFFVLYLIGYSTFLFLAVAVGSSTLYSYRRRNRLKNELLNDYYIPVS
IIIPAYNEEVTIEATIRSLLSLKYKLYEIIVVDDGSKDNTSQKVIDSFKMKRISRPIRIQ
LDCQQEEFVYETLAYKVPITLIRKRNGGKADSLNMGINASRYPYFICMDADSVLQYDSLE
KIVRPVLEHDNVVAVGGAVRPCNGAEIENGRVIHYKLPSNLLACMQVLEYDRSFLAARIL
FDKFNGSIIISGAFGLFRKDVVIAAGGYDSHNMGEDMELVVKLHVYCRKHDMPYLIKYAT
DAICWSQAPESLRDLRKQRRRWHIGLFQSMFKHRTMLVNPKFGLVSFISYLYFLLYELIS
PYIEIFGVLTIILAFIVDLINVPFMILFFMIYAVYSSVLSLTAFFARVQTIDLKLTVLDV
LKAILLCFIEVSFLRFAMAWVRATAFWGYKKKKHQWGRIERKKINIK

Enzyme Prediction     

No EC number prediction in MGYG000001673_00993.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	60	261	3.1e-28	0.9647058823529412
GT2	164	376	5.4e-18	0.9187817258883249

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	5.65e-62	61	276	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	2.02e-49	5	449	2	409	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	6.63e-49	9	404	3	344	N-glycosyltransferase; Provisional
pfam00535	Glycos_transf_2	5.44e-28	60	262	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
PRK14583	hmsR	2.47e-26	59	402	77	373	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK56534.1	2.18e-204	1	466	1	466
CBL04658.1	2.54e-195	11	465	18	472
BAN78238.1	1.75e-192	8	464	13	469
QUO31269.1	1.64e-179	1	463	1	463
QIB55150.1	1.83e-174	1	466	1	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.48e-07	59	195	7	118	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
5EKE_A	7.07e-06	57	171	26	119	Structureof the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa]
5EKP_A	7.07e-06	57	171	26	119	Structureof the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6GDD8	7.64e-29	19	325	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q99QX3	7.64e-29	19	325	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1
Q9RQP9	7.64e-29	19	325	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q7A351	7.64e-29	19	325	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q5HCN1	7.64e-29	19	325	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	37
337	354
358	377
384	406
421	443