CAZyme Information: MGYG000001673_01483

Basic Information

• Species: UMGS1537 sp900552695
• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212; UBA1255; UMGS1537; UMGS1537 sp900552695
• CAZyme ID: MGYG000001673_01483
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862	MGYG000001673_19|CGC1	98060.97	7.9805

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001673	2567696	MAG	United States	North America

• Gene Location: Start: 35151; End: 37739 Strand: -

Full Sequence      

MGQMVIRMKNRNSNSKRNKTRRIFRAAFAAATIFLLLISLSACSGRKNSEIRNRGFENGS
GTSIDDWKQYNYRYDFGGNTECTQISLVDLGFSGQCVRIASQNKNDARIYQKLKVAPNAK
YCVKFDTLYEKIDDDVTEEERGAGLNVSVMNGMQRSGSLYGTVSEWQTVTVYFETTDDQK
SVELSIGIGGYGAESSGTAYIDNVSVEKVDSIPAGNVAFDASTTSSTKTSAPTASIWMKL
LFVALAGGTIVFVILVSLKADKENAANHNPLSQKNPLLNRKDFIILLIMIVVCSAMSFYK
LGNTYAASSYWKASEENESVIVEFDNVETVSRTVYSNSIPANDNAYCYTVFYETEDGSGN
YTELFRIKAGSFFAWERVDKTFTTKRVKIVSTESGLGVNEMGFFRKNDDGEFEKLNVKVT
ETNYNNTRNEEHNPAMLFDEQNTVEPYSSYMSSTYFDEIYFPRTAYEHIHGYSVYEVTHP
PMGKVIMSLGIRIFGMNPFGWRFMGTLFGVALVPLMYLLGLKIFKKRIYAFAAAFLMMFD
FMRLAQTRLATIDSYSAFFILCMYYFMYDYFTQKSYEKKAFWKSLIPLFFCGIMFGLGAS
TKWVCLYTGVGLAFLFFLAKYLEADDIATGRAMLTNKKKSWFTYNFVPTCCACIIFFIVI
PGSIYILSYIPYLAPSPDENLIDIVLDNQKYMYSYHSGLTEGHPYGSAWYTWPVIMRPIY
YYSGGSADIGENMGTSIVSMGNPLVWWTGLACIIPALFYTWKKRDKGMLVAFVGYAVQFF
PWILVTRVAFIYHYFTAVPFLIFMIVYVIKNLIEDGVISKNVMWVYLALVLILFIMFYPV
LTGREVSRSYIDFLRWFGTWSF

Enzyme Prediction     

No EC number prediction in MGYG000001673_01483.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	451	672	2.9e-54	0.9192825112107623

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	2.45e-26	689	857	7	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	6.45e-23	456	862	50	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	3.29e-18	453	667	20	235	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1807	ArnT	6.01e-14	450	862	51	400	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
COG4346	COG4346	2.21e-13	467	722	126	330	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV69574.1	2.29e-159	20	856	2	860
AEV69792.1	1.19e-156	33	862	11	956
ABN54290.1	2.26e-147	35	862	11	968
ADU73726.1	3.17e-147	35	862	11	968
ANV75398.1	3.17e-147	35	862	11	968

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	5.44e-06	680	862	532	729	Structureof S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	2.23e-29	456	860	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	2.23e-29	456	860	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	5.15e-28	456	860	67	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	2.33e-23	477	860	97	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
O67270	1.35e-08	476	646	56	221	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.009887	0.285403	0.704296	0.000301	0.000080	0.000047

TMHMM  Annotations     

start	end
21	43
236	258
283	305
499	521
528	545
549	568
580	599
603	622
642	664
744	761
768	785
790	809
822	841