CAZyme Information: MGYG000001673_01533

Basic Information

• Species: UMGS1537 sp900552695
• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212; UBA1255; UMGS1537; UMGS1537 sp900552695
• CAZyme ID: MGYG000001673_01533
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
869		97899.58	5.104

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001673	2567696	MAG	United States	North America

• Gene Location: Start: 115; End: 2724 Strand: -

Full Sequence      

MLKLYDFSVDYVKNPTIVKTKDLRFGWKLDSDNIDVLQTSYRIIIKNEDGTAADTGIVKS
EDVCDITIDSLKLKSCTDYTVEITVTDNKGETAKFARKISTEILPEEWRGASWIKPAVHI
SGWAPYMRTKFEAKGVKKAIMYASGLGCAEYYINGKRTDDYYIDPPMSNYEKTVFYRRFD
VTELIREGGNALAVLLGEGFYSQSRVWGHNGFKYGDVCAKIKLILYLDNGAVKEICTDTE
NWKYKYSPVTVNNIYGGETYDCRLETPDFSNYDGDEKGWEGVIIDETPKGTLTPSLIPPV
RVIRELPAVNHYGSSGKADGTWIYDIGVNMAGVAEFNIPHSPKGAVYVFRYAETVNEHGE
LDFRSTGSCATQCIQQDIYICRGDVQGEVYRPRFCYHSYRFVEVSGIHDFSQGYGTTPQL
SIVKGIQISTDMAKIAEFSTSYDFLNKFYRITDNTFRSNFHGLPEDCPAREKCGWLGDAQ
VVSNFGLLNYDSAAAYEKYLDDIRTTCEVYGTWQMISPGKRGCGNASPLWGCAQIIIPYY
IYKYYGNKEAVVKNADLMRAWVQNELNRSQDYIISEGLGDWDPAGSNENPRRMPVSHSSS
LMFYEICTIMAELCTDMKANYGIEIGDAAEYFSLAGKIKESFIRHFYDFERHSYGYWGSD
GVALAIGLYPDGERASLIKALCEMIEKDDYEMPTGIYGNKYLAPVLMEEGFGDMALKYLF
NEKHYSFGTMINDNATTIWEEPDMHFIEKRRDRSVASYNHPMHGGFMYFCITHLSGIRPA
KPGFGKFIFKPCFTETADSIKTEFNSPYGTISVEINNDKAAGKRVCAINVPSGSSCIIDI
NAENVTVDGIKCEGQVCVGSGRHETIIFS

Enzyme Prediction     

No EC number prediction in MGYG000001673_01533.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	318	838	1.3e-113	0.9861111111111112
CBM67	124	281	3.5e-21	0.8409090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.92e-53	433	774	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.84e-44	134	304	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.28e-17	319	410	5	90	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.86e-09	776	843	1	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGY42608.1	6.50e-136	2	843	19	860
QGA24281.1	2.88e-124	25	849	55	897
AHF92025.1	1.46e-119	124	834	29	728
SCM59076.1	3.02e-117	26	838	58	898
AIY87265.1	1.29e-113	1	857	1	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.39e-105	5	834	33	892	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	8.10e-73	108	844	287	998	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	5.11e-61	24	814	24	815	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	5.46e-111	14	866	42	948	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	3.92e-72	108	844	287	998	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	9.79e-59	126	848	176	889	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	5.96e-54	107	813	145	853	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001673_01533.