CAZyme Information: MGYG000001674_00464

Basic Information

• Species: UMGS1795 sp900761165
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UMGS1795; UMGS1795 sp900761165
• CAZyme ID: MGYG000001674_00464
• CAZy Family: CE15
• CAZyme Description: Carbohydrate esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		40997.39	6.3964

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001674	1412802	MAG	United States	North America

• Gene Location: Start: 5882; End: 6961 Strand: +

Full Sequence      

MQSTEKNQDGSFLLDYRLPELMEDKTAGTKHWRARREEIIRLLSQQEYGFMPPHLPANVK
TTEKKRYFAGKGILETTVFGFNNQGESFELKANLIYPDGGKQYPFFVFANFSKDVPDKYF
PAEELIDRGFGVISFFYQDVSKDENSFGEGLERLFLKQRRDGDTFGKISLWAWAMSAMLD
YIFDRKLVLNNRVGAIGHSRLGKTALWAAANDERFSFVFSNDSGCSGAALSRNKQGETVA
DITAVFPHWFCKNYLDYAGREDELPFDQHFLLSLIAPRTLVVGAAKEDTWADTINQYLCC
KAAMPAYALYGMGGGFDNDKPVTGKKYGANGIFFRERTGMHYLSRDDWHFYMDIMTDKI

Enzyme Prediction     

No EC number prediction in MGYG000001674_00464.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	27	356	7.8e-68	0.9256505576208178

CDD Domains     

MGYG000001674_00464 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95892.1	2.08e-82	18	355	11	357
QDU94458.1	1.34e-71	7	353	28	420
QNK58798.1	2.57e-70	33	353	28	365
QDV48321.1	9.28e-69	2	353	25	420
AKP53284.1	1.08e-67	2	353	20	412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GRW_A	1.65e-59	121	352	156	390	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	2.57e-59	121	352	174	408	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	3.77e-59	121	352	185	419	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	7.14e-59	121	352	174	408	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]
7B7H_A	1.98e-58	121	352	174	408	ChainA, Putative acetyl xylan esterase [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	2.42e-54	7	353	31	421	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
B2ABS0	1.23e-22	24	311	133	412	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
D8QLP9	4.69e-21	32	312	54	325	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1
P0CU53	4.63e-20	17	312	44	339	4-O-methyl-glucuronoyl methylesterase 1 OS=Wolfiporia cocos (strain MD-104) OX=742152 GN=WOLCODRAFT_23632 PE=1 SV=1
P0CT87	2.30e-19	34	312	131	404	4-O-methyl-glucuronoyl methylesterase 1 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.18.61.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001674_00464.