CAZyme Information: MGYG000001674_00900

Basic Information

• Species: UMGS1795 sp900761165
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UMGS1795; UMGS1795 sp900761165
• CAZyme ID: MGYG000001674_00900
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572		62334.23	9.4986

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001674	1412802	MAG	United States	North America

• Gene Location: Start: 1694; End: 3412 Strand: +

Full Sequence      

MKKKPTLYIIIIAVWLLGLGVLAWSLAAAIANITAAGALIKAFITALLSINTACIAVLWF
GSVKDLVFSLAAVVLRKKFDAEYAKIKPADTKGAAPRVALLYCTCNDFNADALTACRKQN
YSNFYTVILDDSSDAEYIRKINKYRATHGNVTVHRRADKSGFKAGNLNSYLKNNSDYDYF
VVLDSDEIIPPDYIVSALKYFDNFGNCGAVQAKHRASEGTNAFQSLMGMCVLSNGSTVQI
VKNFYGANALMGHGMMISRQCYQKTSGFPLVVAEDISFAVDIKNAGYEIIYAPDIECTEE
FPVNYVSLKKRQCKWTQGNLEYMRKYDGDINKSDMKWFEKLDLKLSHYSLPVVPMLGFML
MLCTIALGFAGYTSIKYSLIVYSIMLLFLCSPLIPDVLVYCKGRKIWLLIPYFIVNIAAY
ASLSPMMISTIIKGCCGKKASFIVTPKTGKKFSLKEAAVYSWDSVAFATAMCILAVAACG
SVLPVIFVAAGCLAAPAIVMLSNIPAKKPRAQKPQRPVSSDFAEKNALPAANVTVASAPV
ITRTAGILPAKSAVNTSANIGSAVKTSMTRGR

Enzyme Prediction     

No EC number prediction in MGYG000001674_00900.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	111	304	2.6e-21	0.8565217391304348

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	6.48e-26	43	432	2	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06421	CESA_CelA_like	4.91e-21	96	321	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
cd06437	CESA_CaSu_A2	2.21e-18	128	318	37	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06423	CESA_like	1.25e-17	110	275	13	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG2943	MdoH	5.48e-15	15	367	66	439	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDL20008.1	4.48e-146	1	516	1	522
QDL19322.1	4.48e-146	1	516	1	522
QIN44161.1	4.48e-146	1	516	1	522
QIN44840.1	4.48e-146	1	516	1	522
QIN42784.1	4.48e-146	1	516	1	522

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q69L19	1.39e-13	124	450	265	594	Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC2 PE=2 SV=2
Q7PC70	1.29e-12	124	450	265	594	Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. indica OX=39946 GN=CSLC2 PE=2 SV=1
Q9ZQB9	2.24e-12	128	360	277	520	Probable xyloglucan glycosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=CSLC12 PE=1 SV=1
A5F1Q0	2.29e-12	112	351	154	413	Glucans biosynthesis glucosyltransferase H OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=opgH PE=3 SV=1
Q9KSG9	2.29e-12	112	351	154	413	Glucans biosynthesis glucosyltransferase H OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999999	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
39	61
350	372
377	399
406	428
467	501