CAZyme Information: MGYG000001675_00372

Basic Information

• Species: UBA1685 sp900546845
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; UBA1685; UBA1685 sp900546845
• CAZyme ID: MGYG000001675_00372
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215		23607.98	8.8725

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001675	2267050	MAG	United States	North America

• Gene Location: Start: 65285; End: 65932 Strand: +

Full Sequence      

MTAAAAAASGKKRSEAVRKKRKQRERARALRVAAIALAAAALLSAAAYFVNLQLEKRTYQ
LAYAEAIKRESAAYGLDPYLVAAVIHCESRGQADACSPKGARGLMQIMPATGEWIAEKLA
LLPFSEDALYEADTNIRLGCWYLSYLFARYDGERDLALAAYNAGPGNVKKWLEDPAYSAG
GRLTVIPFAETEAYVKRVNAASEKYRELYEEELAQ

Enzyme Prediction     

No EC number prediction in MGYG000001675_00372.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	77	205	1.1e-29	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.27e-73	61	204	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.69e-52	59	208	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	8.92e-41	78	201	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	3.99e-31	61	215	137	293	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.12e-30	67	172	1	103	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYH39946.1	4.31e-52	42	210	28	195
QWT54455.1	1.46e-50	42	209	35	206
VTQ87399.1	1.22e-47	42	209	15	183
ACL76418.1	8.89e-46	42	210	23	192
AEY66639.1	2.52e-45	42	212	23	194

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	3.00e-23	43	198	432	585	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	3.08e-23	43	198	461	614	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
5MPQ_A	7.26e-23	56	209	405	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	7.30e-23	56	209	409	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	7.36e-23	56	209	415	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	1.95e-19	54	206	472	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.95e-19	54	206	472	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	9.02e-19	54	206	472	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	9.55e-19	66	200	63	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.44e-16	58	200	1417	1539	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999916	0.000109	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
29	51