CAZyme Information: MGYG000001675_01051

Basic Information

• Species: UBA1685 sp900546845
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; UBA1685; UBA1685 sp900546845
• CAZyme ID: MGYG000001675_01051
• CAZy Family: GH171
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		41200.11	4.6465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001675	2267050	MAG	United States	North America

• Gene Location: Start: 6827; End: 7969 Strand: -

Full Sequence      

MQKVIVSPGAEVLLHAPLPKSVAAKSSRVGLVTNPTGVLPNLRPTYDVLAELYTLAALFS
PEHGVRGDVDAGGDVPDYVDSATGLPVYSTYGPGREAAYRKMAELDCVFFDMQDVGARYY
TYQYTMAEAMEACAAAGVPFVVLARPPMIGCIPQGNILDPGFSSFVGKYPTAVRTGLTIG
EFARFINETEGIGCALTVVPCIGVTRGLYYDETALPFVPPSPAIPTVDCALVYPGTCLLE
GTNLSDGRGTAKPFELIGAPWLRARDAIAALYALPHEGCLYREAYYTPYSAKFRGERCCG
IQIHVTDRAAFRPFETAVRMLSVIRAQNPEFAYTNPDFESSLFGSGALVSDAFDCEQYIA
SLDAPLAEYRKKIEPFYLYE

Enzyme Prediction     

No EC number prediction in MGYG000001675_01051.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	29	379	1.2e-113	0.9971830985915493

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07075	DUF1343	4.22e-148	30	379	1	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
COG3876	YbbC	2.87e-105	25	353	42	374	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH29890.1	1.74e-115	25	379	20	381
ADZ19231.1	1.54e-100	25	352	19	348
AAK78167.1	1.54e-100	25	352	19	348
AWV81974.1	1.54e-100	25	352	19	348
AEI33041.1	1.54e-100	25	352	19	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K05_A	1.02e-54	25	307	29	317	Crystalstructure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]
4JJA_A	4.72e-45	25	260	21	257	Crystalstructure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40407	5.57e-93	25	379	53	414	Uncharacterized protein YbbC OS=Bacillus subtilis (strain 168) OX=224308 GN=ybbC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001675_01051.