CAZyme Information: MGYG000001678_00852

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1
• CAZyme ID: MGYG000001678_00852
• CAZy Family: GT101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		38895.34	9.5984

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001678	1849707	MAG	United States	North America

• Gene Location: Start: 21864; End: 22871 Strand: -

Full Sequence      

MAGMSKMLTICDIIVKELRRYIVFIKKNKMTGRLIVNLFGLRLKFRLPVKNKHADERFAN
LLYELADPRTLEKVKLPKVLNLYDTLYALVDSNKSLARFGDGEFKIMMGESINFQKYDKK
LAERLGEVLSNNTENLMVGIPDVFGYCPSEYFRRVLISSREHLYKYMNFERTYCDAFLTR
QSKFESESKGNDYYRNLKKLWENKDIVIVEGEGSRLGIGNDLFSNVKSIRRILCPIKDAF
SKYDEILASCKKSDGELFIVALGPTATILAYDLCKAGYRALDVGHVDTMYEWFLRKATKS
VHIEGKIVFNEERNKKSLKPCKDKKYYEQIITTVE

Enzyme Prediction     

No EC number prediction in MGYG000001678_00852.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT101	97	308	8e-78	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08759	GT-D	4.46e-93	97	308	1	220	Glycosyltransferase GT-D fold. This domain is found at the C-terminus of proteins such as the probable glycosyltransferase Gly that also contain the glycosyl transferase domain at the N-terminus. It is also found N-terminal in numerous putative glycosyltransferases such as GalT1. GalT1 has been shown to catalyze the third step of Fap1 glycosylation. This domain is structurally distinct from all known GT folds of glycosyltransferases and contains a metal binding site. This new glycosyltransferase fold has been named GT-D.
TIGR03728	glyco_access_1	1.07e-87	79	335	1	265	glycosyltransferase, SP_1767 family. Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39379.1	7.67e-134	24	331	3	312
QWI12255.1	2.74e-65	77	334	34	298
ABY44566.1	1.54e-64	77	334	34	298
QWG83469.1	1.54e-64	77	334	34	298
QWH18731.1	3.07e-64	77	334	34	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PFX_A	3.30e-52	64	306	2	249	Thehighly conserved domain of unknown function 1792 has a distinct glycosyltransferase fold [Streptococcus parasanguinis FW213]
4PHR_A	6.55e-52	78	306	13	249	Domainof unknown function 1792 (DUF1792) with manganese [Streptococcus parasanguinis FW213]
4PHS_A	5.12e-51	78	306	13	249	Selenomethioninesubstituted structure of domain of unknown function 1792 (DUF1792) [Streptococcus parasanguinis FW213]
5V4A_A	2.61e-50	79	306	8	244	ANew Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36],5V4A_B A New Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2URB1	1.02e-46	51	334	522	812	Glycosyltransferase GlyD OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyD PE=1 SV=1
Q9AEU2	2.44e-44	79	306	417	652	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001678_00852.