CAZyme Information: MGYG000001679_00766

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000001679_00766
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265		30260.38	9.2738

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001679	1675843	MAG	United States	North America

• Gene Location: Start: 4429; End: 5226 Strand: -

Full Sequence      

MVTSYRNSKNFGSSWISAANATWYLREARFLNNARNICKTSCAVSGSGYLISASVIEGMH
GWQFHTLTEDIQFTTFCAIHGIRIGYAPAEFFDEQPVTFKASWKQRMRWTKGFYQVFFTY
GKHLVKSTFRYHRFAAYDMFMTIAPGMLLSLISMLANATFLIVGGLSHGFLATEVEMQAC
AASLIMTFAMMYLTFFILALLTTIFEYKHIHCAQKWRLVTNLFTFPIFMFSYIPITVAAL
FLKVDWVPTQHAVNVTLDEVMQGAK

Enzyme Prediction     

No EC number prediction in MGYG000001679_00766.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	7.66e-24	2	73	113	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	1.99e-15	5	238	175	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13632	Glyco_trans_2_3	2.16e-08	2	164	34	189	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
pfam13641	Glyco_tranf_2_3	2.76e-07	1	112	119	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
PRK11204	PRK11204	1.28e-06	44	201	209	362	N-glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33195.1	2.07e-187	1	265	167	431
ATP53496.1	8.39e-187	1	265	167	431
AZH69681.1	1.19e-186	1	265	167	431
AEB07123.1	1.23e-144	2	265	168	431
AKT50107.1	2.91e-129	3	265	166	428

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.06e-06	44	112	210	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
141	163
183	205
218	240