CAZyme Information: MGYG000001680_00268

Basic Information

• Species: UBA10677 sp900553005
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677; UBA10677 sp900553005
• CAZyme ID: MGYG000001680_00268
• CAZy Family: GH4
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430	MGYG000001680_2|CGC1	48958.2	6.236

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001680	1825936	MAG	United States	North America

• Gene Location: Start: 57660; End: 58952 Strand: -

Full Sequence      

MKITFLGAGSTVFARNVLGDCLLSDLKDYEIALYDIDEHRLNESYVIITAMRDKYNKSVA
VNKYTDPKKAFKGANYIINAIQVGGYKPCTVTDFEIPKKYGLKQTIADTLGIGGIFRALR
TIPVMKNYANIMEEVCPDVLFLNYTNPMSMLSGYMQRYTGVKTVGLCHSVQVCVPDLAKN
LEMPELNDAKWKIAGINHMAWLLELTDKNGKDLYPALKKKFNEVRPKHDLVRLDMMNHFG
YYNTESSEHTAEYHPYYIKDKYPEFIEKYNIPLDEYPRRCVNQIAGWEKERDSILNGGNV
EHTRSREYGSRIIEACETDVPFRIHGNVLNTGLIENLPPEACVEVPIMIDSNGLNPCHVG
RLPEQLAALNRTNINVQLMTIQAANTLKKEDVYMAAYLDPHTKAELSLDDIKAMCDDLFE
AHGDWLPKYN

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	2	179	2.4e-63	0.9832402234636871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	0.0	1	419	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
PRK15076	PRK15076	0.0	1	429	2	430	alpha-galactosidase; Provisional
COG1486	CelF	9.07e-169	1	429	4	439	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
pfam02056	Glyco_hydro_4	3.92e-67	2	183	1	183	Family 4 glycosyl hydrolase.
cd05296	GH4_P_beta_glucosidase	8.91e-62	1	426	1	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQI61937.1	3.80e-213	2	430	3	433
QBQ06054.1	6.87e-209	2	429	3	432
AEE97120.1	1.83e-208	2	429	3	430
AGA56646.1	2.55e-206	2	430	3	432
ALC92099.1	2.16e-205	2	430	3	433

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	1.31e-32	1	407	6	426	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	1.03e-27	1	429	5	437	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1U8X_X	8.38e-27	2	428	30	463	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
7BR4_A	3.99e-24	1	355	13	404	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8]
6KCX_A	4.02e-24	1	355	13	404	Crystalstructure of citrate complex of alpha-glucuronidase (TM0752)from Thermotoga maritima [Thermotoga maritima MSB8],7CTD_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8],7CTL_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34645	9.20e-203	2	429	3	431	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
P06720	1.18e-136	2	427	6	446	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1
P30877	1.09e-134	2	429	6	448	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2
Q9X4Y0	1.42e-67	2	429	5	442	Alpha-galactosidase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=melA PE=3 SV=1
D3T426	2.28e-44	1	426	11	450	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001680_00268.