CAZyme Information: MGYG000001681_00054

Basic Information

• Species: Ruminococcus sp900761275
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus; Ruminococcus sp900761275
• CAZyme ID: MGYG000001681_00054
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	MGYG000001681_2|CGC1	40648.81	7.6912

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001681	2557345	MAG	United States	North America

• Gene Location: Start: 28165; End: 29235 Strand: -

Full Sequence      

MRIIQVLPTLSFGDAIGNDTIALKGAISDMGFDSEIYAENVDKRLPTDIAKNIGRLKGLK
SDDIILYHKSTGTELTFKLDEFKCRKIMIYHNITPPEFFAPYSPAAERLTRFGYEGVEFL
RDKVELCLADSSYNKNELIRMGYDCPIEVRPILIKFDDYKQTPDKAILKKYSDGKTNLIF
VGRIAPNKKQENIIRAFYWYKRINPDSRLILVGSYAGMENYFERLAKYVKALGLGDDVVF
TGHIKFSEILAYYRSAHAFVCMSEHEGFCVPLAEAMFFDVPIIAYNTSAISDTLGGSGVL
IDDNDPVFAAGVIDRIISDKNLRNHIISGQRKRLEDFSYDRIRNIFEKQLKDFIKR

Enzyme Prediction     

No EC number prediction in MGYG000001681_00054.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	173	325	4e-33	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	8.27e-37	49	351	70	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03809	GT4_MtfB-like	3.28e-36	21	341	37	355	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
COG0438	RfaB	6.89e-36	55	356	77	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03817	GT4_UGDG-like	1.26e-31	63	341	86	363	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
pfam00534	Glycos_transf_1	3.44e-31	178	333	5	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP37264.1	3.80e-133	1	355	1	355
ASN97925.1	3.80e-133	1	355	1	355
QIX91413.1	1.44e-130	1	355	1	355
QTE73647.1	5.82e-130	1	342	1	344
QTE72662.1	5.82e-130	1	342	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I45_A	1.50e-10	160	326	19	184	1.35Angstrom Crystal Structure of C-terminal Domain of Glycosyl Transferase Group 1 Family Protein (LpcC) from Francisella tularensis. [Francisella tularensis subsp. tularensis SCHU S4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8LDJ8	5.46e-12	178	339	244	412	D-inositol 3-phosphate glycosyltransferase OS=Frankia sp. (strain EAN1pec) OX=298653 GN=mshA PE=3 SV=1
C7R101	3.10e-09	135	340	197	402	D-inositol 3-phosphate glycosyltransferase OS=Jonesia denitrificans (strain ATCC 14870 / DSM 20603 / BCRC 15368 / CIP 55.134 / JCM 11481 / NBRC 15587 / NCTC 10816 / Prevot 55134) OX=471856 GN=mshA PE=3 SV=1
D1A4Q3	4.20e-09	178	340	235	404	D-inositol 3-phosphate glycosyltransferase OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) OX=471852 GN=mshA PE=3 SV=1
D5USX8	4.26e-09	178	341	236	404	D-inositol 3-phosphate glycosyltransferase OS=Tsukamurella paurometabola (strain ATCC 8368 / DSM 20162 / CCUG 35730 / CIP 100753 / JCM 10117 / KCTC 9821 / NBRC 16120 / NCIMB 702349 / NCTC 13040) OX=521096 GN=mshA PE=3 SV=1
P39862	4.91e-09	180	355	202	375	Capsular polysaccharide biosynthesis glycosyltransferase CapM OS=Staphylococcus aureus OX=1280 GN=capM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000005	0.000042	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001681_00054.