CAZyme Information: MGYG000001681_00492

Basic Information

• Species: Ruminococcus sp900761275
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus; Ruminococcus sp900761275
• CAZyme ID: MGYG000001681_00492
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	MGYG000001681_26|CGC1	69994.57	4.1254

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001681	2557345	MAG	United States	North America

• Gene Location: Start: 330; End: 2219 Strand: +

Full Sequence      

MNSKLNKTVSLAAAAVMAASACGSFGLSGAIAAGETSSAATNFPYTIEGENLEGATLWTS
IYENQLPGYSGEGFAYLTGGALSFKVTVPEDGMYKVTARVAQILDKEGSGRTETMAVNGS
EYVKNVPYTDKWTDFDFGIVRLNAGENTIEFLNKYGYMAIDSVTVSVAEKKDYSLATDEL
CDPKATPETKALMKYLKSVYGKHTIAGQQEIYGGGHKNNYEWENEFLENLTGKVPAIRGL
DFMNYNPLYGWDDGSTERAIAWVKERNGILTASWHINVPIDFDNYNLGDAVDWKECTYKN
YQASGSTFNTANVIKEGTKEREYFEAAMEDLAEQLLKLQEANVPIILRPLHEAQGNEGNY
PDGTSWFWWGDRGAEVYKELWKLLYTTLTEKYDLHNIIWEFNSYDYSNSHTWYPGDEYVD
IVAYDKYNVEYNRGDGKSSGPNLLAISSKFDYLFNLTNGKKMVAMAENDTVPAMDNMIIE
DANWLYFCPWYDGGEDGGVAFLGENYQDYEELTKMYQSEYCITLDELPADLYSYGEDPHP
TFPSTGDDKDYLPGDANCDGLVDLADAVLIMQALANPDRYGVNGTDETAITKQGVKNGDV
YGNGDGLTNSDALTIQKFRIGLITELPEV

Enzyme Prediction     

No EC number prediction in MGYG000001681_00492.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	182	526	4.1e-92	0.9933993399339934
CBM35	53	165	2.6e-20	0.9663865546218487

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	5.23e-40	182	492	2	284	Glycosyl hydrolase family 26.
cd04086	CBM35_mannanase-like	2.86e-22	46	166	2	119	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
COG4124	ManB2	2.61e-10	341	436	178	266	Beta-mannanase [Carbohydrate transport and metabolism].
cd04082	CBM35_pectate_lyase-like	8.95e-09	63	149	16	106	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd04083	CBM35_Lmo2446-like	1.43e-08	67	165	21	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU21037.1	1.78e-278	1	535	1	528
QIN54096.1	3.55e-200	41	528	24	501
ADU75242.1	1.53e-173	39	570	31	540
ALX09217.1	1.53e-173	39	570	31	540
ANV76969.1	1.53e-173	39	570	31	540

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	6.80e-62	44	527	12	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6D2X_A	2.01e-45	180	527	4	334	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6D2W_A	5.43e-45	152	527	67	425	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
6HF2_A	1.05e-43	168	492	33	316	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6HPF_A	6.32e-37	184	527	10	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	8.17e-64	33	527	34	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55297	3.49e-54	45	529	24	463	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P49425	6.60e-52	50	534	20	463	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55298	3.98e-51	45	529	23	461	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55296	7.28e-51	45	529	24	462	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.147826	0.851658	0.000099	0.000096	0.000069

TMHMM  Annotations     

start	end
12	34