CAZyme Information: MGYG000001682_00462

Basic Information

• Species: Paramuribaculum sp900760855
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900760855
• CAZyme ID: MGYG000001682_00462
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453	MGYG000001682_2|CGC5	51184.03	6.4974

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001682	2633261	MAG	United States	North America

• Gene Location: Start: 234509; End: 235870 Strand: -

Full Sequence      

MEIDIQYFNDRTVRTTEQIKAVAQEAKSTFVLICTGLTVPPIEEMTLRRMETIAESTGAV
MIYSDHRTTADNGTTELQRCLDYTPGSVRDDFYFGPLLLIRTDALRRATTQMDADYTAAG
IYDLRLRLSRIGHICHIPEPLYTIPLEDKRKSGERQFDYVNPRNRESQIEMEMAFTSHLK
AIGAYLTPVFKTPDYGENWPVTASVIIPVRNRKTTICDAVRSALSQQCSFSFNVIVVDNH
SSDGTTELLRDIKDPRLIHVIPPEENMGIGGCWNKALNHEKCGKFAVQLDSDDLYSSTGT
LQAIIDTFEAEQCGAVIGSYSLTDIALQPLPPGIIDHREWSDSNGRNNALRINGLGAPRA
FATAIARMYPMPDVSYGEDYAMCLRICREYRIGRIYDVLYLCRRWEGNTDAALTRDAENR
NNAYKDFIRATELRARIAMNATNRKAVNHGRKH

Enzyme Prediction     

No EC number prediction in MGYG000001682_00462.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	204	334	8.2e-19	0.7588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	1.27e-19	205	322	1	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	3.98e-17	204	319	1	114	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	8.71e-14	204	317	6	113	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd06433	GT_2_WfgS_like	5.12e-13	204	318	1	111	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06423	CESA_like	2.76e-11	205	318	1	114	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO47901.1	7.26e-162	16	440	42	467
AZS29649.1	2.25e-161	16	436	26	448
QRO51331.1	9.35e-160	16	436	26	448
AHF12419.1	3.92e-157	19	440	62	484
QUT26898.1	4.65e-157	13	442	56	486

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q077R2	4.06e-06	204	298	5	96	UDP-Glc:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-glucosyltransferase WfaP OS=Escherichia coli OX=562 GN=wfaP PE=1 SV=1
P33697	9.11e-06	206	327	15	130	Succinoglycan biosynthesis protein ExoO OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoO PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001682_00462.