CAZyme Information: MGYG000001682_01059

Basic Information

• Species: Paramuribaculum sp900760855
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900760855
• CAZyme ID: MGYG000001682_01059
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	MGYG000001682_7|CGC1	37419.62	7.3934

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001682	2633261	MAG	United States	North America

• Gene Location: Start: 27062; End: 28057 Strand: +

Full Sequence      

MASSRLLKKIALTTIVIFNSVCAHAYSPADVQAYIAQYKATALQNEKEYGIPATIILAQG
ILESGAGTSELTRASNNHFGIKTGSKWKGKEHLAWDDETQKSRFRCYESAAESFRDHARI
LTTNSCYRSLFKINIYDYRGWAHGLKKAGYATAPHYAQALIGIIDQYKLYDINGGAKLKS
GKTVVITRYITVEKPVFLQDCLLDEEEESEEQAMIAEAETRYAVLINDVHCTVLQPGETL
ASISRKYDISPVQLLKYNECDSEYQIKEGDIIFLDKKKKKFEGPQDVYIARQGETLYDVS
QEFGIQLHQLAKLNKMKDYARLQDGDRIILK

Enzyme Prediction     

No EC number prediction in MGYG000001682_01059.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	41	169	2.1e-35	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.86e-34	1	171	5	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	4.38e-32	28	170	157	309	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
TIGR02541	flagell_FlgJ	6.27e-29	28	168	145	294	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK05684	flgJ	4.38e-27	28	168	149	298	flagellar assembly peptidoglycan hydrolase FlgJ.
PRK12712	flgJ	1.33e-26	27	164	193	339	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR67483.1	4.66e-68	32	317	32	283
QJR58959.1	4.66e-68	32	317	32	283
QJR63222.1	4.66e-68	32	317	32	283
QJR71820.1	4.66e-68	32	317	32	283
ALA74116.1	4.66e-68	32	317	32	283

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	1.36e-14	30	168	2	149	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.87e-14	30	168	2	149	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	4.55e-13	32	165	2	144	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	5.47e-13	32	165	3	145	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	3.60e-12	32	165	3	145	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75942	2.51e-16	28	168	146	295	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	2.51e-16	28	168	146	295	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
Q9KQ15	6.28e-13	33	175	163	317	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P15931	7.41e-13	30	168	151	298	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
O32083	1.13e-11	47	171	64	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000846	0.612477	0.385869	0.000345	0.000237	0.000210

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001682_01059.