CAZyme Information: MGYG000001682_01647

Basic Information

• Species: Paramuribaculum sp900760855
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900760855
• CAZyme ID: MGYG000001682_01647
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403		45253.33	8.4615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001682	2633261	MAG	United States	North America

• Gene Location: Start: 3385; End: 4596 Strand: +

Full Sequence      

MKPKILLVNKFYYRRGGDCVCTLNLEKLLLEHGHDVAVFAMQYPQNLPSKWSGYWPEEVS
FGGGFKDKTDALKRVLGLGDVKEKFSALLSDFKPDVVHLNNIHSYLSPVLAELAHKAGAK
VVWTLHDYKLICPSYSCLDPMGNICEKCFNSKLHVLTSRCMKGSIAASTIAWLEAMTWNR
KRLEKNVDMFICPSSFMKLKMRRGGFNDRKLITLCNFVAPDMLKSFKQLDFNASRQDYYC
YAGRLSSEKGVATLLNTASRLPYKLKIAGDGPLLQELQQKYKECANIEFLGRVDSDGVRS
LLSNARFSVLPSECYENNPLGVIESLCAGTPVVGARNGGIPELIEGTPHRGIIFTPGSET
ELAAAIEQMWNYDTPNGDISRKAIKEFSPETHYKQLMQIYNCN

Enzyme Prediction     

No EC number prediction in MGYG000001682_01647.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	234	371	4.5e-27	0.89375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03823	GT4_ExpE7-like	7.97e-51	4	397	1	356	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
cd03801	GT4_PimA-like	2.87e-46	4	401	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.39e-42	5	401	4	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03811	GT4_GT28_WabH-like	1.76e-29	4	393	1	349	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03794	GT4_WbuB-like	2.48e-26	4	369	1	359	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB37514.1	3.08e-147	3	400	8	398
QQR08246.1	3.08e-147	3	400	8	398
ANU64387.1	3.08e-147	3	400	8	398
AFL79241.1	6.48e-144	4	401	2	390
QCD34525.1	1.66e-143	1	401	1	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EJI_A	6.06e-06	168	371	119	322	Structureof a glycosyltransferase [Campylobacter jejuni],6EJI_B Structure of a glycosyltransferase [Campylobacter jejuni],6EJK_A Structure of a glycosyltransferase [Campylobacter jejuni],6EJK_B Structure of a glycosyltransferase [Campylobacter jejuni]
6EJJ_A	6.06e-06	168	371	119	322	Structureof a glycosyltransferase / state 2 [Campylobacter jejuni],6EJJ_B Structure of a glycosyltransferase / state 2 [Campylobacter jejuni]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48454	4.91e-19	5	343	3	325	Uncharacterized 42.6 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
Q8S4F6	1.63e-10	89	386	185	458	Sulfoquinovosyl transferase SQD2 OS=Arabidopsis thaliana OX=3702 GN=SQD2 PE=1 SV=1
Q59002	1.59e-08	4	400	2	381	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
A5U3B9	8.19e-06	182	344	142	311	GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol dimannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) OX=419947 GN=pimC PE=3 SV=1
P0CF99	8.19e-06	182	344	142	311	GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol dimannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001682_01647.