CAZyme Information: MGYG000001682_02177

Basic Information

• Species: Paramuribaculum sp900760855
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900760855
• CAZyme ID: MGYG000001682_02177
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000001682_36|CGC1	37045.37	5.457

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001682	2633261	MAG	United States	North America

• Gene Location: Start: 223; End: 1164 Strand: +

Full Sequence      

MTTIPIVFAFDNNLALQASVCIYSLLVNAKEDTIYDVYFLYPGKTGLEINYLKKVFTEYP
RHKAHYIGIGDDFDKAFQIRGINTVTYYRLLIPELIPEYDKIIYSDVDVIFQDDLSDIYL
NTDLEGNYLGAVNSLSHFDKDRREYYENQLNLDVSKIFYAGNIIINSKAIREARLKNTFM
SMIETKYKFQDMDILNITCQNNVKFLPPSFCVTTYFCDMVVSDKEKLTSVWSEDDIKEAF
SKGIIHYNGQKPWNGFCVNFDIWWEYYRKSPVFDSKYYFDFFYSRLNELDALPLWKRIKI
LVRYFVYGKRNNP

Enzyme Prediction     

No EC number prediction in MGYG000001682_02177.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	4	254	4.5e-46	0.8715953307392996

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	9.50e-50	4	254	1	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	5.36e-34	5	254	1	249	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	2.86e-30	3	266	2	257	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd00505	Glyco_transf_8	4.63e-15	78	255	75	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
PLN02870	PLN02870	3.70e-10	82	277	326	517	Probable galacturonosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24918.1	8.13e-132	1	311	2	312
QDZ63604.1	8.41e-101	1	311	1	306
QQN57026.1	8.41e-101	1	311	1	306
AQX83626.1	8.41e-101	1	311	1	306
AMX51747.1	1.62e-98	1	305	5	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	2.63e-17	2	260	300	575	ChainA, WbbM protein [Klebsiella pneumoniae]
1SS9_A	1.21e-12	79	258	76	257	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	3.30e-11	79	258	76	257	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
5GVW_A	2.95e-08	69	266	68	250	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVV_A	9.36e-08	69	266	68	250	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0WV13	4.53e-08	82	253	327	503	Probable galacturonosyltransferase 13 OS=Arabidopsis thaliana OX=3702 GN=GAUT13 PE=2 SV=1
Q8GWT1	6.04e-08	82	253	326	502	Probable galacturonosyltransferase 14 OS=Arabidopsis thaliana OX=3702 GN=GAUT14 PE=2 SV=1
A0A0H2URJ6	1.61e-07	69	266	68	250	Glycosyltransferase GlyE OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyE PE=1 SV=1
P19817	5.86e-06	49	256	69	273	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999999	0.000044	0.000003	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001682_02177.