CAZyme Information: MGYG000001683_00100

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Frisingicoccus
• CAZyme ID: MGYG000001683_00100
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	MGYG000001683_3|CGC1	46142.78	4.2903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001683	2591996	MAG	United States	North America

• Gene Location: Start: 12690; End: 13937 Strand: +

Full Sequence      

MPETNLIDKGQLRISAVSTEGNVPIDDATIEISSTGEPDQILEQITTDNSGNSDTIELDA
PPVEYSLEPGDTQPYSEYNLKITAPGFEEVEISGIQILSGQLGLSNVRMTPVVTQTPAYN
PLVIGAHTLWKLYPPKIAEAEIKDMNETGEIVLSRVVIPETVIVHDGPPNDTSAANYFVP
FRDYIKNVASSEIYATWPESSIIANVLAILSFTLNRVYTEWYRNKGFDFTITSSTAYDHF
FVYGRNVYESISRVVDTIFSNFLSRPNVRQPILTQYCDGKRVSCPNWMSQWGSKSLGDQG
YTPLEIIRYYYGNDMYINTAEQISGIPSSWPGADLTVGSTGAKVRQMQEQLNRISQAYPA
LPSLTADGIYGENTRRAVADFQRIFGLPVTGVVDYPTWFKISDIYVGVSRIAELQ

Enzyme Prediction     

No EC number prediction in MGYG000001683_00100.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	1.98e-14	340	398	1	54	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	1.13e-09	335	401	39	102	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	2.30e-08	331	398	117	180	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
TIGR02669	SpoIID_LytB	1.06e-04	177	311	117	260	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
pfam13620	CarboxypepD_reg	0.002	17	101	6	73	Carboxypeptidase regulatory-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT50293.1	6.58e-202	8	415	11	419
QJU21247.1	1.69e-201	10	414	11	415
QIX92999.1	4.82e-201	10	414	11	415
ASN94441.1	6.85e-201	10	414	11	415
QRP40879.1	6.85e-201	10	414	11	415

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001683_00100.