CAZyme Information: MGYG000001684_00042

Basic Information

• Species: DONG20-135 sp009831105
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; DONG20-135; DONG20-135 sp009831105
• CAZyme ID: MGYG000001684_00042
• CAZy Family: GT4
• CAZyme Description: Alpha-galactosylglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000001684_2|CGC1	42809.1	6.655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001684	1923305	MAG	United Kingdom	Europe

• Gene Location: Start: 17970; End: 19085 Strand: -

Full Sequence      

MDNRIVINMLSSADKIEGQGVGSAYLEQVKLVSEGAPDLFDVRINSIKAADINHAHTVDP
QNYVKMKMNNAGANVCYVHFLPDTLNGSIQLPKALFAVFKKYVVSFYKAADYLIVVNPTF
MDELEKYGIPREKMVYIPNYVSKEDFYEKPRNERNLIRQKYGIAEDAFVVIGVGQVQTRK
GVLDFVDVAKRLPDIQFVWCGGFSFGAITDGYAELKEVVENPPANVKFLGIIPRQEMNDF
YNLADVLFMPSYNELFPMAILEAVNLKRPLVLRDLELYEDILFHKYQNADDNEGFSNLIR
KLHEDPDYYRTCAQESGFISEYYSKENVLKIWKEFYTRVYEEQLSQNAKAQKRKQKLAKR
AFKEAKRQEKL

Enzyme Prediction     

No EC number prediction in MGYG000001684_00042.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	163	311	1.2e-19	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.63e-29	50	336	83	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	9.75e-27	43	343	77	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03794	GT4_WbuB-like	2.18e-23	75	333	127	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03798	GT4_WlbH-like	1.97e-21	99	271	140	304	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
cd03817	GT4_UGDG-like	4.39e-21	50	339	85	372	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA03527.1	3.22e-202	1	342	3	343
QQR25823.1	9.23e-202	1	342	3	343
ASU17271.1	9.23e-202	1	342	3	343
ANU70307.1	9.23e-202	1	342	3	343
QSI25395.1	3.06e-201	1	342	3	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F9F_A	1.47e-06	171	310	27	167	CrystalStructure of the Putative Mannosyl Transferase (wbaZ-1)from Archaeoglobus fulgidus, Northeast Structural Genomics Target GR29A. [Archaeoglobus fulgidus DSM 4304]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DPV9	3.66e-98	4	338	32	367	Alpha-galactosylglucosyldiacylglycerol synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=cpoA PE=1 SV=1
Q8KQL6	7.57e-26	16	305	13	296	Processive diacylglycerol alpha-glucosyltransferase OS=Acholeplasma laidlawii OX=2148 GN=dgs PE=1 SV=1
Q93P60	4.21e-07	137	326	181	374	Alpha-monoglucosyldiacylglycerol synthase OS=Acholeplasma laidlawii OX=2148 GN=mgs PE=1 SV=1
O32272	9.71e-07	51	288	110	328	Putative teichuronic acid biosynthesis glycosyltransferase TuaC OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaC PE=2 SV=1
P26470	1.27e-06	111	334	140	373	Lipopolysaccharide 1,2-N-acetylglucosaminetransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=waaK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001684_00042.