CAZyme Information: MGYG000001685_00637

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-964
• CAZyme ID: MGYG000001685_00637
• CAZy Family: CBM74
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1133		121187.99	4.3508

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001685	2227904	MAG	United Kingdom	Europe

• Gene Location: Start: 6110; End: 9511 Strand: -

Full Sequence      

MAKHQKKVVSTVLAALMVASMCVLPTTASAASTTEKDSGATSLPSKYATNPNNQVGKNKT
ITIDGDMSDWSEDMLIAQGAAWDVANHWKGGHENCVLDTYSLYAAWDNDNLYVAWQMVNT
TDTWARSGDGPLSDGGRVLDVPLILALSVDPNSTSMSNKNTDGGPIWGEKMGLSFDTHVD
RLLYMSGKPGNGDPGMFKAVDANGNTNYKEGCSLFAKSGIEYKMAMGNISSSIIGLNSSD
SPDDVFSEDSDWVDYKTYVGSQGVHNTQYDSFYEIKIPFSTLGVDANYIQNNGIGAMLVA
TRGESALDCIPFDPSMIDNATGSYGGGDPSSTHEKDDEDVITVPFARIGKTGGVTPTTPT
TPTTPTTPTTPTTPTTPTTPTTPTTPTTPTVPTTPTTPYDVTGQKTVTVSEGDTVTFTVD
AKTAKKIGSYRITTKYDSSAFSIDTSYSGDGVNTLAANNGQEVVNTSNAGSVVALALSET
LKPFTATNGTTLQTIQFKAKKSGTYTISYIIDEMLDTDENDLVVNCKPVSGVTISENADV
NGGIEDATTGFSTVTFKKGDTVTYNVDLKFAKMLYGFKTNVIYDKSMLEVQNVTFPNVTG
TTLFNTEKSGLVSTIGVGSPTETYDFTTQKNLVTVTFKATKDGTSTISYLMREVVALDLI
PQYDETTGKALTSDVSSTSTATSSGEEITTDEWATGATTAATEISVKKGDKVNCWAEITI
PANGMDLMSWTADFLYDGKMLELDTTFADNNGFASGTSAVDYALGNTTTPVELPGGLVVQ
SKTDIIGRASYTDIDVRDKGFGFNTGKVTKLICIQFIAKETGTAKLAYRMRDLCDMNMVT
SYVDDTTYQAKNGAKVAYMVKVNSTEDPTTPTTPTVPTTPTTPTTPTTPTTPTTPTEFDE
YATGATTAATEISVKKGDKIDYWVEITIPSNGKDINGWMVDFLYDNSKVEYNPAFANNNG
FASGTAAIDYVLGNTTTPATLPGGKIVQVTTDYPGRATFADAVLGYNGFGFNNGNVTKLI
CVQFIAKETGKVKLAYRMRDISDVDLDSSYVDVNTYQPKGGAKFNHNVKIESSAILGDLN
GDGKVSTLDLTLWGRWYAQGQENLTEEQIKLADINGNGRIDIMDKIKLSVLIK

Enzyme Prediction     

No EC number prediction in MGYG000001685_00637.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM74	47	347	3.5e-76	0.9967948717948718

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14256	Dockerin_I	2.30e-09	1076	1124	1	48	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
cd08547	Type_II_cohesin	2.03e-07	552	648	8	106	Type II cohesin domain, interaction partner of dockerin. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II cohesins; their interactions with dockerin mediate attachment of the cellulosome complex to the bacterial cell wall.
pfam00404	Dockerin_1	6.95e-07	1077	1133	1	53	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd08547	Type_II_cohesin	2.15e-06	406	508	9	106	Type II cohesin domain, interaction partner of dockerin. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II cohesins; their interactions with dockerin mediate attachment of the cellulosome complex to the bacterial cell wall.
cd14252	Dockerin_like	6.52e-05	1077	1132	1	56	Dockerin repeat domains and domains resembling dockerin repeats. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT07491.1	1.83e-159	46	357	224	534
AWX97480.1	4.17e-139	38	356	753	1072
AWX95531.1	4.17e-139	38	356	753	1072
QZS61962.1	4.74e-134	74	356	1	286
CDM67953.1	1.79e-63	46	356	777	1091

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000344	0.996040	0.002897	0.000275	0.000224	0.000182

TMHMM  Annotations     

start	end
12	34