CAZyme Information: MGYG000001685_00708

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-964
• CAZyme ID: MGYG000001685_00708
• CAZy Family: CBM21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246	MGYG000001685_9|CGC2	27800.12	6.2474

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001685	2227904	MAG	United Kingdom	Europe

• Gene Location: Start: 23637; End: 24377 Strand: -

Full Sequence      

MKHKKIFALTLVLTLLVGIFAMVPSVGAVSENPVKLIYAKPPQTGLAVGAIGYVEVENIA
YDKKVTIHYSFDGKEWDDCDAEYYKPTHGNYEAWKFETPTKVPSYRGTITVEFAIKYEVN
GQTYWDNNNGQNYSVYAGYSDPGRFDFGIGGIASRTAYKSGDNVRGWLQLKDLGNPKVVK
VIYTTNNWATTNEVNAQYYTTFYANNYVQEWSYTIPTSSSNLKFKLSYTVNGITYVDDNF
GDYYTV

Enzyme Prediction     

No EC number prediction in MGYG000001685_00708.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	51	135	6.5e-23	0.8130841121495327

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03370	CBM_21	1.12e-25	31	135	4	112	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
pfam16760	CBM53	1.87e-09	58	135	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT07351.1	6.09e-90	1	246	1	249
QNK41593.1	6.20e-49	18	245	23	241
QUH30304.1	1.47e-40	18	245	26	258
QUH30919.1	2.36e-39	52	244	60	254
QQZ61948.1	1.28e-38	1	246	3	252

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EEF_A	2.16e-13	52	135	50	135	ChainA, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]
2DJM_A	6.91e-13	52	135	23	104	ChainA, glucoamylase A [Rhizopus arrhizus],2V8L_A Chain A, Glucoamylase A [Rhizopus arrhizus],2V8M_A Chain A, Glucoamylase A [Rhizopus arrhizus],2V8M_B Chain B, Glucoamylase A [Rhizopus arrhizus],2V8M_C Chain C, Glucoamylase A [Rhizopus arrhizus],2V8M_D Chain D, Glucoamylase A [Rhizopus arrhizus],2VQ4_A Chain A, GLUCOAMYLASE A [Rhizopus arrhizus],4BFN_A Chain A, Glucoamylase [Rhizopus arrhizus],4BFO_A Chain A, Glucoamylase [Rhizopus arrhizus]
2M83_A	2.17e-07	52	135	48	133	Solutionstructure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0VCR4	3.83e-12	52	135	171	256	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1
Q9UQK1	7.06e-12	52	135	171	256	Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
Q86XI6	7.62e-12	52	135	147	232	Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1
Q803M0	1.11e-11	51	135	150	236	Protein phosphatase 1 regulatory subunit 3B OS=Danio rerio OX=7955 GN=ppp1r3b PE=2 SV=1
Q8C767	1.92e-11	52	149	146	253	Protein phosphatase 1 regulatory subunit 3B OS=Mus musculus OX=10090 GN=Ppp1r3b PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000677	0.998327	0.000289	0.000266	0.000218	0.000195

TMHMM  Annotations     

start	end
7	29