CAZyme Information: MGYG000001685_00765

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-964
• CAZyme ID: MGYG000001685_00765
• CAZy Family: GH13
• CAZyme Description: Glycogen debranching enzyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1026	MGYG000001685_10|CGC1	115252.6	6.1509

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001685	2227904	MAG	United Kingdom	Europe

• Gene Location: Start: 28195; End: 31275 Strand: +

Full Sequence      

MQIKHCNDMMPPLLSPTERGGEINYIISVFMAIEKTKVKETKTLQESYESIGQYYNAKEI
YPLYDGNDLGANYSPKQTIFKVWAPSANMVSLNLYKTGSDVEHDAGRILTTQMKKNPDNG
VWSVAISSDLKGVYYTYTVLANGESRETQDVYSYAVGVNGNRSMVVDLKSTDPEGWSSDK
HVLLEKPTDAVIWEVHVRDFSISRTSGVSAEKRGKYLAFTQRGTRVNRTKEYSTCVEYLV
EQGINYVHLNPVFDFGSVNEAMHTSQYNWGYDPVNFNVPEGSYSTNAAKGEVRINEFKQM
VQALHDRGIGVIMDVVYNHVYSAGDSCFEKTVPGYYFRMYSQYQYFNGSGCGNVTASDKA
MFRKFMIDSITYWAKEYHIDGFRFDLMGCHDVITMNKIREALDEIDPRILMYGEPWMADW
MSNGIDGELACISQNAFKLSPRIGMFSDKIRNSLKGNTDDESIGYIQGATNVNNEIKSGM
MGGACDTFGRWSREPMQCITYNSAHDNLTLWDKILKSNGNTDYNGHNSILLAQNKLSAVI
VLTSQGVPFYLAGEEFARTKYGDHNSYKSADGVNKIDWTRVIRYNNLVQYYKGLMQLRAS
YTPFREGDDLSIKSTYFVENGSAIGYTIQNTTKNAENEWGTVAVLVNNSASPKALKLKVN
GGSVPDKWAVVVNSDKAGVEKLGAIHGTEINVPPRSALVLVDDTTFGRLKKTEKNYRTVV
VKHINKETNESVRKVASHYIKGTTYRTYPCYSILFDYTLVGSDGELNGVIGDNDVEVKYF
YEKDSRENFTLERRQVTDDGTPVISPVSKKVKKGDKYAVKPQAVQGYELDTDRLPKSIGT
ISGDTTITYIDKLIPAKPLRVHYFNHNNWMAPHIYIYDDRGGSARALTDQWPGTVMSAEG
NEGWWGFGDVDIDEAQVMFSDGIFGQDPGAHHPGYNVSGEVWIKDQKVYFNSKVVVSHVD
VNGNKLIDDVIIEGKNKCSEDTYVAMPIKELGRVLNSIGEVSGMWSTTVENVVFIYESKK
DKLLSE

Enzyme Prediction     

No EC number prediction in MGYG000001685_00765.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	237	555	2e-108	0.9930795847750865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02104	pulA_typeI	0.0	61	681	4	605	pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases.
cd11341	AmyAc_Pullulanase_LD-like	0.0	188	598	1	406	Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins. Pullulanase is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. Pullulanases are very similar to limit dextrinases, although they differ in their action on glycogen and the rate of hydrolysis of limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
COG1523	PulA	8.52e-134	59	700	59	689	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
TIGR02103	pullul_strch	9.20e-117	59	701	117	895	alpha-1,6-glucosidases, pullulanase-type. Members of this protein family include secreted (or membrane-anchored) pullulanases of Gram-negative bacteria and pullulanase-type starch debranching enzymes of plants. Both enzymes hydrolyze alpha-1,6 glycosidic linkages. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family is closely homologous to, but architecturally different from, the Gram-positive pullulanases of Gram-positive bacteria (TIGR02102). [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PLN02877	PLN02877	3.41e-104	64	579	211	798	alpha-amylase/limit dextrinase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT07019.1	1.16e-253	28	708	30	712
QCT05893.1	1.78e-208	55	849	35	826
APO32485.1	1.74e-200	53	706	24	672
QCT05892.1	4.63e-200	64	779	49	781
QCT07748.1	2.81e-198	40	943	17	1008

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LSA_A	3.61e-208	26	781	22	792	ChainA, Pullulanase [Ruminococcus bromii]
7LSR_A	5.67e-207	26	781	22	792	ChainA, Pullulanase [Ruminococcus bromii]
7LSU_A	6.05e-207	26	781	22	792	ChainA, Pullulanase [Ruminococcus bromii]
7LST_A	6.24e-207	26	781	22	792	ChainA, Pullulanase [Ruminococcus bromii]
2WAN_A	1.10e-139	64	700	313	919	Pullulanasefrom Bacillus acidopullulyticus [Bacillus acidopullulyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33840	8.90e-131	14	700	164	840	Pullulanase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=pulA PE=1 SV=2
C0SPA0	5.61e-107	64	605	102	620	Pullulanase OS=Bacillus subtilis (strain 168) OX=224308 GN=amyX PE=1 SV=1
Q8GTR4	5.91e-65	64	579	204	791	Pullulanase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PU1 PE=1 SV=2
P07811	4.53e-60	70	579	315	921	Pullulanase OS=Klebsiella aerogenes OX=548 GN=pulA PE=1 SV=1
A0A0H2UNG0	1.08e-59	64	605	447	1035	Pullulanase A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=spuA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001685_00765.