CAZyme Information: MGYG000001685_01301

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-964
• CAZyme ID: MGYG000001685_01301
• CAZy Family: CBM21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
251		28353.42	4.7623

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001685	2227904	MAG	United Kingdom	Europe

• Gene Location: Start: 8980; End: 9735 Strand: -

Full Sequence      

MKKKKVFALALVLTLIVGLFSLVPSVGAVSDRPVKLIYAKPAYTSTGTGATGYVEIENIA
YDKEVTIHYSFDGKEWYDCAAEYYKPTFGNYEAWTFETTGRSPVYREAITVQFSIKYEVN
NQTYWDNNNGKNYSVSLGYLAGASYDFGVGGIADASASKNSKTDTVYGSLQLKNLGYQKD
VKVIYTTDNWTTTNEVSAKYDRFTSMNDSVEIWNYSYETNQNNIQYKLSYTVNGTTYIDD
NFGDYYTVNVY

Enzyme Prediction     

No EC number prediction in MGYG000001685_01301.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	47	135	3.9e-21	0.8504672897196262

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03370	CBM_21	5.29e-22	51	136	22	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
pfam03370	CBM_21	3.13e-10	156	249	11	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
pfam16760	CBM53	2.16e-08	58	135	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT07351.1	2.09e-89	1	248	1	249
CQR53753.1	5.11e-46	30	249	29	253
AIQ70729.1	5.11e-46	30	249	29	253
QQZ61948.1	1.02e-45	1	249	3	253
QUH30304.1	6.39e-44	34	247	34	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2DJM_A	5.30e-12	42	136	13	105	ChainA, glucoamylase A [Rhizopus arrhizus],2V8L_A Chain A, Glucoamylase A [Rhizopus arrhizus],2V8M_A Chain A, Glucoamylase A [Rhizopus arrhizus],2V8M_B Chain B, Glucoamylase A [Rhizopus arrhizus],2V8M_C Chain C, Glucoamylase A [Rhizopus arrhizus],2V8M_D Chain D, Glucoamylase A [Rhizopus arrhizus],2VQ4_A Chain A, GLUCOAMYLASE A [Rhizopus arrhizus],4BFN_A Chain A, Glucoamylase [Rhizopus arrhizus],4BFO_A Chain A, Glucoamylase [Rhizopus arrhizus]
2EEF_A	1.94e-09	52	135	50	135	ChainA, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]
2M83_A	2.48e-08	35	135	31	133	Solutionstructure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07683	8.10e-11	15	136	14	130	Glucoamylase 1 OS=Rhizopus oryzae OX=64495 PE=1 SV=2
Q86XI6	4.36e-08	52	135	147	232	Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1
Q0VCR4	1.66e-07	51	135	170	256	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1
Q6IN01	1.95e-07	52	140	146	236	Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1
Q8C767	2.63e-07	52	140	146	236	Protein phosphatase 1 regulatory subunit 3B OS=Mus musculus OX=10090 GN=Ppp1r3b PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000662	0.998313	0.000320	0.000267	0.000220	0.000195

TMHMM  Annotations     

start	end
7	29