CAZyme Information: MGYG000001686_00299

Basic Information

• Species: DNF00809 sp900604965
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; DNF00809; DNF00809 sp900604965
• CAZyme ID: MGYG000001686_00299
• CAZy Family: GT4
• CAZyme Description: Putative glycosyltransferase EpsF

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		41945.8	6.8748

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001686	1260761	MAG	United Kingdom	Europe

• Gene Location: Start: 1783; End: 2919 Strand: -

Full Sequence      

MRVLQVIGAMDRGGAETMIMNLYRAIDRERIQFDFLVHEQRLCDYDEEIADLGGSVFREL
PRFVVSNACSYRRACRDFFDRHPEHEIVHGHIGSSALIYLPEARRAGKAVIAHSHARNFP
LSPTEVAFRALSLPVRFQADGFLACSLEAGIDRFGRAVVGGKRFSVLRNAIDVAAFQCDE
PAHRQAKRDFGWADRVVVGHVGRFDPVKNHRFLIDAFARFKRRVPEALLVLVGRGAIEDE
VRAHAVDSGCADDVVFWGVTDEVARLQKAFDLFVFPSLSEGLPVSVIEAQAAGAPTLLST
GVPELSVMDARIATRLDLTQGPQVWVDAMVGALERSPERALGARAVRAAGFDIERTAAWL
ERYYRSLADASTKRTEGE

Enzyme Prediction     

No EC number prediction in MGYG000001686_00299.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	196	300	5.3e-24	0.6625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03812	GT4_CapH-like	1.48e-77	2	326	1	321	capsular polysaccharide biosynthesis glycosyltransferase CapH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. capH in Staphylococcus aureus has been shown to be required for the biosynthesis of the type 1 capsular polysaccharide (CP1).
cd03811	GT4_GT28_WabH-like	7.94e-39	2	305	1	300	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03801	GT4_PimA-like	1.57e-36	11	365	12	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03807	GT4_WbnK-like	2.64e-35	2	365	1	362	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
COG0438	RfaB	6.32e-31	1	367	3	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS67166.1	2.98e-154	1	369	2	370
QLF91524.2	4.23e-98	2	364	6	365
ARE14944.1	6.16e-98	2	364	18	377
ARE12535.1	6.16e-98	2	364	18	377
QRV02243.1	1.58e-93	2	373	4	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6N1X_A	5.46e-06	187	293	191	297	ChainA, Glycosyltransferase [Staphylococcus aureus subsp. aureus CN1]
6D9T_A	5.72e-06	187	293	207	313	BshAfrom Staphylococcus aureus complexed with UDP [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71055	1.63e-60	2	364	7	374	Putative glycosyltransferase EpsF OS=Bacillus subtilis (strain 168) OX=224308 GN=epsF PE=2 SV=1
A0R043	2.10e-17	44	340	44	345	GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimB PE=1 SV=1
D5UJ42	2.57e-15	85	347	138	417	D-inositol 3-phosphate glycosyltransferase OS=Cellulomonas flavigena (strain ATCC 482 / DSM 20109 / BCRC 11376 / JCM 18109 / NBRC 3775 / NCIMB 8073 / NRS 134) OX=446466 GN=mshA PE=3 SV=1
P9WMZ2	2.08e-14	84	304	85	317	GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimB PE=3 SV=1
P9WMZ3	2.08e-14	84	304	85	317	GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pimB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001686_00299.