CAZyme Information: MGYG000001688_01581

Basic Information

• Species: Hungatella_A hathewayi_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella_A; Hungatella_A hathewayi_A
• CAZyme ID: MGYG000001688_01581
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
577	MGYG000001688_20|CGC1	63831.93	5.2431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001688	5654180	Isolate	not provided	not provided

• Gene Location: Start: 18075; End: 19808 Strand: +

Full Sequence      

MIDIGSKPFRLNKEQRDWVYQTLASMTPEEKLGQMFVDLSYGDYEETFVKDRLERTKAGG
LRYMNLTAKEMLEHNRMYQKHSKIPLLIAANIEAGGNGACKDGTNVGCEVKVAATGETKD
AYRLGYIGAVEAKAIGCNWAFTPIVDLSLNWRNPIISTRTWGSRVETVIACGRECLRGIH
DGGLAATAKHFPGDGVDERDHHYSSTVNTMSVEEWDETFGRIYGEMIAGGVEAVMAGHIM
LPSYQKKLNPEMKEDEILPASLCKELLTGLLREKLGFNGVIVTDASHMVGFSSRMSRRDA
LAAAIHAGCDMILFFNDVEEDLSYLRDAVSDGRLSMERIDEAVTRILALKASQGLHRPVC
LSDDGLSVVGCEEHRAAAAEISRRSVTLAKQVGETPLPITVEKYRRIMIVPVHTPTPEFA
KFVGAVSGAVKIAEDLKERLAGLGFEVELFVSPLAKAEGNPKNAYDYKESIEKFKRTYDL
VLTVANCGSFGVTQRLNWDTPKGGFEVPWYVYDVPELFISFNCPFHLADAPAVKTMINCY
DSQESTVDALIDKLTGREEFTGISPVDVFCGLMDTRL

Enzyme Prediction     

No EC number prediction in MGYG000001688_01581.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	79	313	5.4e-47	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	9.10e-60	26	405	1	356	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.20e-59	27	349	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	9.37e-25	121	334	99	302	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.47e-18	11	399	29	407	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV62881.1	5.56e-194	1	577	1	589
QJA10123.1	8.35e-191	1	576	1	588
AKK12002.1	1.68e-190	1	577	1	589
ALC92197.1	3.68e-186	2	577	4	586
QFK71386.1	5.57e-186	2	577	4	588

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	1.52e-133	4	577	6	567	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
6K5J_A	2.99e-51	25	565	10	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	7.47e-46	67	568	98	617	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.63e-45	67	568	72	591	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.82e-45	67	568	102	621	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	3.82e-146	1	577	1	564	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	4.09e-45	67	568	98	617	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	1.36e-24	79	397	93	425	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q1H075	1.37e-22	121	320	101	288	Beta-hexosaminidase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=nagZ PE=3 SV=1
Q7NWB7	2.08e-22	119	320	101	290	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001688_01581.