CAZyme Information: MGYG000001688_01740

Basic Information

• Species: Hungatella_A hathewayi_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella_A; Hungatella_A hathewayi_A
• CAZyme ID: MGYG000001688_01740
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000001688_29|CGC1	41913.2	4.7243

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001688	5654180	Isolate	not provided	not provided

• Gene Location: Start: 1193; End: 2278 Strand: +

Full Sequence      

MIERRVLEEQLNLVSARMLSLKSNGMPEKYPISLIDIQCWEWPQGVGLFGLYRYYRMTDR
RDIRDFLITWYDVHLKEGVPERNVNTTSPMLTLTYLYEETHNENYLAFIKDWADWMMKDK
KLIRTGDGCFQHMITGDPNDKEILIDTLFMAVLFLVRAGRILDRNDYLEEAGYQILSHIK
YLLNKQEGLFYHGFHFGRNDNYGGILWGRGNCWYTIVVMELVQEMELDGALKRFLLNVYE
NQVTALKRYADKETGLWHTVINDEDSYLELSASSAFLGGIMMGVRLGILKREEFQELIDQ
SLSSLLTYIAEDGTVLGVSYGTPIGMTADFYKEIPCCPMTYGQALMILALQEAMNPFWQS
S

Enzyme Prediction     

No EC number prediction in MGYG000001688_01740.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	39	354	7.8e-88	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.48e-82	40	354	34	350	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.10e-73	27	352	14	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ94867.1	1.30e-189	1	358	1	358
SET87383.1	3.21e-167	1	360	1	360
AGX06452.1	3.62e-125	2	355	3	353
ANY67857.1	1.63e-117	1	355	1	351
QZN73749.1	8.00e-113	1	355	1	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.31e-77	40	358	65	381	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.47e-73	40	358	66	382	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	1.44e-64	40	357	47	372	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	2.97e-20	40	361	39	371	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.26e-19	40	361	29	361	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	3.13e-50	40	355	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	1.63e-19	40	361	39	371	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
T2KPL9	8.90e-07	146	355	161	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001688_01740.