CAZyme Information: MGYG000001688_03436

Basic Information

• Species: Hungatella_A hathewayi_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella_A; Hungatella_A hathewayi_A
• CAZyme ID: MGYG000001688_03436
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830		91608.12	5.7511

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001688	5654180	Isolate	not provided	not provided

• Gene Location: Start: 14775; End: 17267 Strand: +

Full Sequence      

MKHGTIIKNMTVEEKAAFLSGKNEWQTRDFPRLGISSILCSDGPHGVRKQAGAGDHLGLN
PSLPATCFPTAATVAGSWDEELAREVGQALGEEAAALGVDVLLGPGLNIKRSPLCGRNFE
YFSEDPYLSGKMAAAYVKGIQSQGVYACPKHFAVNSQELRRMAMDSVVDERTLREIYLTG
FEIAVKEGGAKALMTSYNQVNGTYANENEHLLKEILRDEWNYEGIVITDWGGSNDHVRGV
ANRSNLEMPTPGFDSARQILAALEDGKLTMEELDICVDDLLDAVLTLTANREERAAAGGK
GKTVETPGEFDKAAHHALARRAAAESMILLKNLPDQDPILPIKENCKVAFIGDFAITPRY
QGAGSSMVNAIRVETVQQMAGDYPFQLVGCVPGYQRGGKVDEALVKAALDLAREAEVVVY
CFGLDEISEVEGMDRKHMRISQNQIELLESLVKVNPNIVGVISAGSPVEMPWHYCCKAIL
HGYLGGQAGAGAILDVLTGKVNPSGRLSETYPIRYEDTPALRCFPSVERNSEYREGIYVG
YRYYDTSRVRVQYPFGYGLSYTSFAYSNLEVTEEGASFDLENTGKRDGAEVAQMYVGCWD
GKVFRPEKELKGFRKVYLKAGEKQRVSIPFDDKTFRYWNVKTNRWETEAGTYGIFVGSCV
LDIRLSSSITLAGTGAPLPYDMEKLPSYRTGLVQSVETEEFETLLGHPVTSGKWSGELGI
NDAVCQMYYAKSGLARFIYRVLTNRVEKNEAKGTPDLNLLFQYNIPFRAIAKMTGGMVSM
EMAYGMTDAVNGHFFRGMGRVIGGFFRNRKYNKEYEKKLLATPPVSEPTK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	237	7.4e-70	0.8935185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.06e-76	32	657	101	751	beta-glucosidase BglX.
COG1472	BglX	3.75e-65	31	355	56	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.02e-49	327	541	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	4.34e-46	5	657	55	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	5.07e-39	32	281	63	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU18245.1	0.0	1	819	1	808
QRT31068.1	0.0	1	819	1	807
QEI32524.1	0.0	1	819	1	807
QHB25014.1	0.0	1	819	1	807
QBE98345.1	0.0	1	819	1	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.26e-207	6	674	8	671	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.76e-174	7	681	9	673	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.50e-129	2	671	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	3.78e-128	2	671	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.67e-107	6	663	9	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.24e-206	6	674	8	671	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.44e-162	7	679	9	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.59e-161	7	679	9	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	5.91e-127	7	664	50	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P27034	9.54e-122	6	671	5	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001688_03436.