CAZyme Information: MGYG000001688_04243

Basic Information

• Species: Hungatella_A hathewayi_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella_A; Hungatella_A hathewayi_A
• CAZyme ID: MGYG000001688_04243
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		42109.97	4.511

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001688	5654180	Isolate	not provided	not provided

• Gene Location: Start: 86333; End: 87424 Strand: -

Full Sequence      

MRKREALEQMLEQVTACMMSMKNPGMEEKFPISLIDMECWEWPQGVGLYGLFLRYRSSKD
EEILNFLIRWFDSRLSEGVRERNVNTTAPMLTLSYLYEITGKQEYLDYIAAWTDWMMDGK
GLLRTGDGCFQHMITGDANDGEMLIDTLFMAVLFLARAGHILGREDCIQEAEYQMLNHIK
YLYNRETGLFYHGWSFHGNHNYGKVMWGRGNSWYTIGLMEYLEENQVPDSLKRYLLSVYN
SQAEALKRYQDKENGLWHTVITNPDTYVEISASAAFLAGIMKGVRLGALNDEEYRDTIRR
GVAGILDYVREDGTVEQVSYGTPIGWDEEFYQQIVCCPMTYGQALMIFLLQELLEPYWAG
LSE

Enzyme Prediction     

No EC number prediction in MGYG000001688_04243.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	39	354	4.2e-92	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.11e-87	1	355	10	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.26e-77	27	354	14	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET87383.1	5.28e-183	7	361	7	361
BCJ94867.1	6.23e-172	4	358	4	358
APO45381.1	4.95e-132	7	352	7	348
QZN73749.1	7.02e-132	7	352	7	348
QLG41208.1	5.70e-131	7	352	7	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	4.07e-80	40	358	66	382	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	4.43e-79	4	358	23	381	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	2.05e-68	40	352	47	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	3.57e-19	40	356	39	366	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.51e-18	40	356	29	356	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	2.53e-49	40	355	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	1.95e-18	40	356	39	366	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001688_04243.