CAZyme Information: MGYG000001688_04300

Basic Information

• Species: Hungatella_A hathewayi_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella_A; Hungatella_A hathewayi_A
• CAZyme ID: MGYG000001688_04300
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525	MGYG000001688_120|CGC1	58934.22	4.2099

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001688	5654180	Isolate	not provided	not provided

• Gene Location: Start: 18876; End: 20453 Strand: -

Full Sequence      

MMELVKKNIHMNRWKGNASTQITLDDDFIVPDTMDDMAQVILDTGDVVVESVKNQGERVQ
VKGKLNFQVLYRKAEGGLQALGGSIPFDEMINVPDLDEKDYVGLSWELEDLNAGIINSRK
LSMKAIVTLEVRVETLYDVEAASDIDTGETDAADNVNVESMKRDVDVAAIACRRKDTYRI
KEDISLSGNKPNIDRVLWNEMRLRGVNTRPMDGQIHVDGELTVFIIYSGEGEETPMQWLE
ESIPFSGEVELPEAVEEMIPVINVRLVHKDLEAKPDYDGEMRDLEVDAVLELDMKLYEEQ
NMELLSDMYSTNRELVLQTGEVCFDKLLTHNVGKCKVSEKVNIKNAERILQICHNEGNIK
IDEVEVKDDGLHIDGVLEVKLLYLTADDAEPVRSSTEVVPFHYVAEAPGINEDSVYQMNT
GLEQMTAVMMGSDTIEIKAVITLDILVLQPVCEPVITNVNVEPMDMQKLQELPGIVGYIV
QPGDSLWKIAKKFHTTVDNIMMANGLTDSNIHPGERLILVKEIAR

Enzyme Prediction     

No EC number prediction in MGYG000001688_04300.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12673	DUF3794	7.72e-16	192	274	1	80	Domain of unknown function (DUF3794). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 90 amino acids in length. The family is found in association with pfam01476.
pfam12673	DUF3794	2.80e-15	349	429	2	79	Domain of unknown function (DUF3794). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 90 amino acids in length. The family is found in association with pfam01476.
pfam12673	DUF3794	5.99e-15	36	116	1	80	Domain of unknown function (DUF3794). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 90 amino acids in length. The family is found in association with pfam01476.
pfam01476	LysM	2.69e-13	478	519	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	1.40e-12	478	519	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASN93744.1	5.22e-261	2	525	1	535
QRP41598.1	5.22e-261	2	525	1	535
QJU21944.1	4.26e-260	2	525	1	535
QRV18795.1	7.31e-260	1	524	1	523
QQQ98613.1	8.13e-258	2	525	1	535

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001688_04300.