CAZyme Information: MGYG000001689_01011

Basic Information

• Species: Blautia coccoides
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia coccoides
• CAZyme ID: MGYG000001689_01011
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
502		57082.67	4.4459

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001689	6086770	Isolate	United States	North America

• Gene Location: Start: 81558; End: 83066 Strand: +

Full Sequence      

MVFSILENEYWYGGYVYGSHVQPYHAASEAEIDLRRNDSTNQAVPFFVSTKGRYLWCEEG
FLLHFGGGNITIDRDVELREGYVNLKGAYLAACKEHFPFSDVRLSDEFFKNPVYNSWIEL
TFWQNEKDILSYADHILENGMPAGVLMIDDGWSDYYGKWDFSREKFPHAEEMLKTLHSKG
FSVMLWICPYITPDTLQYRQARDMDILIKNPDGKPLITEWWNGYSAALDLSAPAAVEWLD
EQLEALRAIGVDGFKFDGADVLYYPDDIVTSGGVTPNEMARLWCAYAEKYPLNELRVAFK
AGGMSLMQRLCDKPHNWGEEGIMALLPDTLMQGITGHPFGSPDMIGGGEYMNFQENSDNL
DQELFNRHSEIACLLPVMQFSAAPWRVLGQDSYEKILKSVKLRERYMPRILELAHHAAQT
GEPIARYMAYEFPEGGYEGINDQFMLGEDILVAPICEKGRTSRNVAVPKGKWRFLGTVIE
SEGAVMELAPEDGEPIVLEKCD

Enzyme Prediction     

No EC number prediction in MGYG000001689_01011.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	117	480	2e-72	0.8641686182669789

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	4.65e-163	110	472	1	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam01055	Glyco_hydro_31	2.73e-52	122	496	32	434	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
COG1501	YicI	5.46e-51	117	496	270	662	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06597	GH31_transferase_CtsY	2.56e-33	117	380	14	287	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
PRK10426	PRK10426	5.73e-32	38	497	133	615	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB55881.1	0.0	1	502	1	502
QMW76252.1	0.0	1	502	1	502
QBE95882.1	0.0	1	502	1	502
QQQ91205.1	1.72e-228	172	502	1	331
ANU77871.1	1.72e-228	172	502	1	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7U_A	2.12e-31	33	472	277	768	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]
2F2H_A	2.53e-27	114	484	269	647	Structureof the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	2.55e-27	114	484	269	647	Structureof a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
5I0D_A	3.24e-26	33	472	277	768	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e],5I0D_B Cycloalternan-forming enzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e]
4KMQ_A	3.27e-26	33	472	298	789	1.9Angstrom resolution crystal structure of uncharacterized protein lmo2446 from Listeria monocytogenes EGD-e [Listeria monocytogenes EGD-e],4KWU_A 1.9 Angstrom resolution crystal structure of uncharacterized protein lmo2446 from Listeria monocytogenes EGD-e in complex with alpha-D-glucose, beta-D-glucose, magnesium and calcium [Listeria monocytogenes EGD-e],5HPO_A Cycloalternan-forming enzyme from Listeria monocytogenes in complex with maltopentaose [Listeria monocytogenes EGD-e],5HXM_A Cycloalternan-forming enzyme from Listeria monocytogenes in complex with panose [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6NSJ0	1.60e-61	107	496	311	707	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
Q69ZQ1	3.16e-61	105	492	308	705	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
P96793	2.30e-28	44	494	195	653	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
P31434	1.38e-26	114	484	269	647	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
Q9F234	3.46e-24	123	496	271	664	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000013	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001689_01011.