CAZyme Information: MGYG000001689_03964

Basic Information

• Species: Blautia coccoides
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia coccoides
• CAZyme ID: MGYG000001689_03964
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569	MGYG000001689_17|CGC1	64337.86	6.2093

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001689	6086770	Isolate	United States	North America

• Gene Location: Start: 33423; End: 35132 Strand: +

Full Sequence      

MVNLREKPYYLNEEQIQWVEDTIAGMTTEEKIGQLFVNMVANAEERKPENIKKVLDTYHP
GAIRYHNAPKEELWEMADCLQKTTKIPLLIASNCEAGGNGGCQGGTPIANGAAMAAIDSP
EEVFKMAEISAREAAAVGCNWNFAPVVDLLYNWRNTIVQLRAFNDSPEDVIRYAKAFFKG
MKTQNIATCMKHFPGDGTEENDQHLIMGINEYDCDKWDRTYGKVYKELIDEGVMTIMAGH
IALPAYSRKLRPGIKDEEIRPATLAPELITDLLKGKLGFNGLVVTDASHMIGMFGATIPR
SRQVPQAIAAGCDMFLFFNEREEDFAYMMEGYQSGIITEERLQDALHRILGVKAALNLHK
LQKEGKLTAPKENLAVVGCAEHHKASRDFADKYVTLVKDRLHYLPMTPKRYKRIKLMYIG
SEATVIAGMKFESNDKNIISDLVSQLEGTGFEVDAGVPAKKGKIEDFKRQYDCVLLVLNV
QGFAQYNTMRVKWDEPVKQPWYMSELPTFVVSLSNTNNLIDVPMARCYINSYMDHHESFA
ATLEKMMGKSEFKGRYNENVFCGRWETRF

Enzyme Prediction     

No EC number prediction in MGYG000001689_03964.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	81	316	1.8e-51	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	4.87e-62	26	428	1	369	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	8.92e-58	27	352	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	4.64e-27	113	360	80	307	beta-hexosaminidase; Provisional
PRK15098	PRK15098	7.24e-17	19	416	38	415	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW79114.1	0.0	1	569	1	569
QIB54599.1	0.0	1	569	1	569
QBE97674.1	0.0	1	569	1	569
QTQ12174.1	3.24e-300	1	569	1	569
QTQ13616.1	9.28e-300	1	569	1	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	2.01e-122	7	568	9	566	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	5.62e-40	26	424	42	465	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.05e-39	26	424	16	439	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.73e-39	26	424	46	469	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3SQL_A	2.96e-33	80	353	78	346	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	4.24e-122	1	567	1	562	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	3.07e-39	26	424	42	465	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q7NWB7	3.29e-23	121	323	97	290	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1
P48823	2.27e-22	125	399	142	419	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q1H075	1.09e-21	32	323	3	288	Beta-hexosaminidase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001689_03964.