CAZyme Information: MGYG000001690_01334

Basic Information

• Species: Ruminococcus_G gauvreauii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_G; Ruminococcus_G gauvreauii
• CAZyme ID: MGYG000001690_01334
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
815	MGYG000001690_8|CGC3	93930.31	6.4695

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001690	4096044	Isolate	Canada	North America

• Gene Location: Start: 109633; End: 112080 Strand: +

Full Sequence      

MQRELFEVKRERFHLLDPDVYILQGSWPKEYEPQVLLDGRRISDVRLEDWENTSALERFA
DLDLMKGKKVTLFVRLPQDLNKCKRLKIYALRGNEKILWFSIAVRDLVRRQGKPFYYIEE
EKASPSSKTLKVRGWAVYRTPVTISVYDEQGKKIPCDIQRNNRVDAVEMFKETQVESKCG
FYLELDGVKTKTVYLVFRAEGSKAVYPIQMQSAFIVKNKVQRLAKKGTRYLASHGVKALA
VKVAGKIAGMKKAPVSYDKWLPRHLPTSAELDRQRQAVFAVRPKFSIVVPLYKTPLLYLE
ALIASVKEQTYPEWELCLSDGSGPDSPIADALLRYAGADERIRVISHEAPLKISENTNAA
IAAATGEFIVFADHDDVLTPNALYECVKALNEQPETEIFYSDEDKMSMDGHKFFQPHFKP
DFNLDLLCTVNYICHLFVARRSVIEKAGVLRPEFDGAQDYDFIFRCIEASDRICHIPKIL
YHWRSHEDSTSENPESKLYAFDAGQRAVQAHYDRLGIRAEVSKGEYLGLYRTRFLRDYDP
LISIIIPNKDHTEDLDRCIQSIEEKSTYKNYEYIIVENNSTEEETFEYYKKLELENPRAH
VIYWDGIFNYSLINNFGAQHAKGEYFLLLNNDTEIINPDCLEELLGYCMRDDVGAVGARL
YFEDDTIQHAGVVIGFGGIAGHCFVMQPRGYTGYCHRIICAQDYSAVTAACMMVKRSIFE
QVGGLSEELQVAFNDIDFCMKIRKAGKLIVYNPYAELYHYESKSRGLEDTPEKVARFNRE
IAIFEKKWPDIFKTGDPYYNPNLTLDSQDFSLRRI

Enzyme Prediction     

No EC number prediction in MGYG000001690_01334.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	286	445	3.3e-22	0.9764705882352941
GT2	543	722	4.3e-19	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	9.21e-93	283	484	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	8.49e-43	544	761	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.07e-27	540	788	3	247	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	2.27e-21	298	491	12	201	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	4.34e-18	543	719	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL24563.1	0.0	1	815	1	814
CBL21587.1	0.0	1	815	1	815
QIB58019.1	0.0	1	815	1	816
QMW77451.1	0.0	1	815	1	816
QJU15224.1	0.0	1	815	1	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	5.32e-06	286	390	8	109	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.90e-143	283	812	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.48e-102	238	814	268	842	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P9WMY2	2.36e-06	707	784	183	259	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	2.36e-06	707	784	183	259	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001690_01334.