CAZyme Information: MGYG000001690_01347

Basic Information

• Species: Ruminococcus_G gauvreauii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_G; Ruminococcus_G gauvreauii
• CAZyme ID: MGYG000001690_01347
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	MGYG000001690_8|CGC4	35236.47	8.6382

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001690	4096044	Isolate	Canada	North America

• Gene Location: Start: 125214; End: 126140 Strand: +

Full Sequence      

MPKSVDVIIPTYHPGKEFRELVKRLLVQEYPVDHIFIMNTGEEDWDEQIGMLSDKIVVEH
LEKAGFDHGGTRHRAIQKSSADIVICMTQDAMPKDRSLVGSLVESFDDTAVKAAYARQLP
ARDCGVIECYTREFNYPEQSRIKRKEDLPALGIKTYFCSNVCAAYDRKTYLELGGFVRHT
IFNEDMIFAAGLIGHGYAVAYTADARVVHSHNYSGIQQLRRNFDLAVSQAQHPEIFADVP
SEGEGIRMVKQTAGYLLRKRPYLIPKLIWQSGCKYLGFRLGRRYERLPKGMVMKLTMNRD
YWSRNTKG

Enzyme Prediction     

No EC number prediction in MGYG000001690_01347.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	3.81e-12	6	168	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	4.03e-11	2	208	53	263	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
COG0463	WcaA	2.75e-09	1	221	2	211	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd06423	CESA_like	3.64e-09	7	181	1	177	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	9.20e-08	2	211	1	213	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM10252.1	3.50e-125	4	302	5	304
QUO22269.1	4.64e-124	1	304	1	305
QYX25912.1	3.41e-123	2	304	4	306
CBK76837.1	1.91e-122	3	303	27	336
QRO35954.1	7.94e-122	2	304	4	306

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	7.15e-66	4	303	2	303	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001690_01347.