CAZyme Information: MGYG000001690_01427

Basic Information

• Species: Ruminococcus_G gauvreauii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_G; Ruminococcus_G gauvreauii
• CAZyme ID: MGYG000001690_01427
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
275	MGYG000001690_9|CGC1	30457.69	5.1536

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001690	4096044	Isolate	Canada	North America

• Gene Location: Start: 89717; End: 90544 Strand: +

Full Sequence      

MALFQGNIFPKTLGFETQVYVSLPYDGHRYQKDGPTKSLILLHGISDNASGWIRHGLADE
FAARYNIAVIVPEGHKSFWLDMKYGGHYTEYLTGELPEMMGNMFHIPADPDHLMIAGLSM
GGFGALHAALSEPGVFAAVGSFSGVTDIRAFFSEAERLGEVSDCGANFINEIAAIVGEGG
TAGEREDLGCLAKRLRAAEVPKIYLACGTEDLLVHQQNKAFYHLLCKCHLDVMYETWEGI
HDWIFWRSALNRFLEYAVGKPEEDDVFGGIIPYKK

Enzyme Prediction     

No EC number prediction in MGYG000001690_01427.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	11	256	1.2e-44	0.9691629955947136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	9.20e-24	35	256	53	307	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	1.59e-16	12	251	3	240	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
PRK10439	PRK10439	2.61e-11	109	250	286	399	enterobactin/ferric enterobactin esterase; Provisional
COG2382	Fes	2.19e-09	104	257	170	295	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG3509	LpqC	9.43e-07	33	144	58	177	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMQ56447.1	3.27e-13	12	253	152	380
ADV81363.1	2.07e-12	19	250	171	383
BCS34250.1	4.13e-12	13	251	115	336
AMY11314.1	1.21e-11	13	253	151	374
SDE76860.1	1.32e-11	19	253	169	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	1.89e-45	1	261	2	265	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
7L0A_A	2.75e-27	1	258	9	259	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
6VH9_A	9.23e-27	7	258	9	253	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]
4ROT_A	1.27e-21	13	256	20	256	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
7B5V_A	5.37e-11	19	255	157	382	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	7.75e-35	1	256	1	260	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
P10478	8.38e-08	30	257	75	276	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P10768	4.81e-06	34	145	43	175	S-formylglutathione hydrolase OS=Homo sapiens OX=9606 GN=ESD PE=1 SV=2
Q08E20	4.81e-06	34	143	43	173	S-formylglutathione hydrolase OS=Bos taurus OX=9913 GN=ESD PE=2 SV=1
Q9R0P3	4.81e-06	32	145	41	175	S-formylglutathione hydrolase OS=Mus musculus OX=10090 GN=Esd PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999924	0.000095	0.000003	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001690_01427.