CAZyme Information: MGYG000001691_01774

Basic Information

• Species: Aeromonas veronii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii_A
• CAZyme ID: MGYG000001691_01774
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
562	MGYG000001691_16|CGC2	61816.98	4.7352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001691	4542842	Isolate	not provided	not provided

• Gene Location: Start: 141359; End: 143047 Strand: +

Full Sequence      

MKKTRIALLLANMMLSDHLWAAEAYDINKSYPGGSQVNYNGQVFEARWWANPGQTPGVVA
ANEWDTTWKLIVEGGVTPPDTGSGDKSTPPDGSTITVYMSQAELDAKELALTDFPAMAAV
KASIVTRDNLVVEAVQPGRADNPDNVKRVEGVLSESQFNYLFPLRAPEYTYRGLLQAVAK
FPALCSDYSDADAICRKSLATMFAHLAQDTGGHESSRPEAEWRQALIYVREKGWTETITG
GYNAECHSDVWQGQQWPCGTFDNGEFKSYFGRGAKQLSYNYNYGPFSEVMFGTVRTLLDR
PDLVADTWLNLASAVFFYIYPQPPKPSVLHVIDGTWQPNDHDRQSGLIPGFGVTTQIING
RVECGGSAEHAQSQNRINYYREFANYLGVPVSADEVLGCKGMNYFDEKGTGSLSTYWDLD
WRYVAENPNGGKSYACQLVGYQTRFSAFKKGDYSRCVQHFYPEVVIEDNGGGTNLPPVAT
ITGPAQAEGGGKVILSAQHSSDPEDKPLAYSWTIPAGTFAPALDQVTLELTLPNSVTDTK
LDIKLTVTDEGGLSRSTNHVLW

Enzyme Prediction     

No EC number prediction in MGYG000001691_01774.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	145	399	3.8e-71	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00325	chitinase_GH19	1.78e-71	153	399	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	6.40e-41	152	390	1	225	Chitinase class I.
COG3979	COG3979	4.85e-26	89	284	5	181	Chitodextrinase [Carbohydrate transport and metabolism].
cd12215	ChiC_BD	5.33e-06	24	58	2	39	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.
smart00495	ChtBD3	1.51e-04	22	58	1	40	Chitin-binding domain type 3.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY76514.1	0.0	1	561	1	569
QQB18943.1	0.0	1	561	1	569
QTL94788.1	0.0	1	561	1	569
ANB54297.1	0.0	1	561	1	569
ANB68606.1	0.0	1	561	1	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BAA_A	1.74e-33	149	389	2	228	TheRefined Crystal Structure Of An Endochitinase From Hordeum Vulgare L. Seeds To 1.8 Angstroms Resolution [Hordeum vulgare]
3CQL_A	4.22e-32	149	389	2	228	CrystalStructure of GH family 19 chitinase from Carica papaya [Carica papaya],3CQL_B Crystal Structure of GH family 19 chitinase from Carica papaya [Carica papaya]
1CNS_A	5.80e-32	149	389	2	228	CrystalStructure Of Chitinase At 1.91a Resolution [Hordeum vulgare],1CNS_B Crystal Structure Of Chitinase At 1.91a Resolution [Hordeum vulgare]
7V92_A	4.10e-31	169	389	29	228	ChainA, GH19 Chitinase [Ficus microcarpa],7V92_B Chain B, GH19 Chitinase [Ficus microcarpa],7V92_C Chain C, GH19 Chitinase [Ficus microcarpa],7V92_D Chain D, GH19 Chitinase [Ficus microcarpa]
4J0L_A	5.03e-30	149	389	3	229	CrystalStructure of a Family GH19 Chitinase (W72A/E67Q mutant) from rye seeds in complex with two (GlcNAc)4 molecules [Secale cereale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P52404	2.71e-36	151	405	68	307	Endochitinase 2 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB2 PE=2 SV=1
P52403	2.67e-35	151	405	70	309	Endochitinase 1 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB1 PE=2 SV=1
P52405	5.06e-35	151	405	70	309	Endochitinase 3 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB3 PE=2 SV=1
Q05538	1.98e-34	151	405	74	313	Basic 30 kDa endochitinase OS=Solanum lycopersicum OX=4081 GN=CHI9 PE=1 SV=1
P24091	2.07e-34	152	405	78	315	Endochitinase B OS=Nicotiana tabacum OX=4097 GN=CHN50 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000311	0.998870	0.000203	0.000223	0.000193	0.000174

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001691_01774.