CAZyme Information: MGYG000001691_02073

Basic Information

• Species: Aeromonas veronii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii_A
• CAZyme ID: MGYG000001691_02073
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1104	MGYG000001691_18|CGC1	120950.71	5.0521

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001691	4542842	Isolate	not provided	not provided

• Gene Location: Start: 151520; End: 154834 Strand: +

Full Sequence      

MKIRPLALSVALCCGGVLLSGCNDSASSGNDNGVKPEVKAPWNFDLYLVGEFSGWGREEK
FKLTFKEGIYRLDNLKMNSGMSPFKVAGPEWTKYPDFSADSRKETSIFPGQVYPMYYQNN
GQNNRLVVTEKGLLDIQVKVTNDDLAAPAIEFSMVRDDPNYSESLYLKGIDGNLSPVLQM
IYQGDKQYVMVAKLTTGEHKIKIASAQEGIGFGLNGAISLNNPVKMQRCDAQCQLATVRV
EQEGYYKFLLDASLDENAPLLQVSVAGEGDLGMINPHEGHELIEKREYETYKPGVTETAT
FSVKQTSDEYRSYAQSTTQELRDPGENFTTYQEQSDLPRLRSGNMVFDALFALAAHEMRQ
NSVAQVKDGSYNGGQAIPCDCFETGAKWHYVWTRDLSYATDLGLGALDPMRARNSLRFKL
SDFRAELTSDLDSLIPQGRQIIQDTGTGGSWPISTDRMSWALGAERVLAALPDAERRAFL
PDVFEGLSNTIESDRLAAFDSADGLYVGEQSFLDWRDQTYAKWITADIAHIGMSKSLSTN
VTHYQGLRLAARVAGELGHDELAIRYNQWAGDLKLAINRAFWLADEKMYASLINTSTDQS
PAYKFDLLGESLAILAGVADEAQAKEIISRYPMGPYGAPVYFPQQPDMPVYHNRAIWPFV
SAYGLKAAAMVQNVAVVDHHIDSLMRGAALNLSNMENLEWLSGQPSLMDLTHPDLTGPVI
NSQRQLWSVGGYLGMVTDTTFGYKVEEGGIRIKPFVTAHLHKLMGAKPEAALKGLNYRGK
QIDIVLQLPELGGEGSYYPVRGITLNGVPVGEQISENMLAPGNRIEVTLGAAVADDQGIR
LIKDVAPLDVENRQVFAPTEPTLLGVSEQSGKLVVALQDSVNKGALSYNIYRDGKLVASG
LDRATSWVDDMVLQPGQAYCYSAEAVYPESGNRSHHAKPVCYQPALQHIAIDAANVSHTG
SVSAADGAIPVPYLKDWGRPDDSLLVQGVKLDGKRTIRLQYSNAQHAINLGVTNGVKRIS
VLGGGKVVASGMVQMPHVMKEGDLKPLRDSTPFVVDLPAGEYDIRVSDFYNMSYLKANDT
YNDAGGQKGAVNLIDLASITVSAR

Enzyme Prediction     

No EC number prediction in MGYG000001691_02073.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06202	GDE_C	7.85e-07	442	730	68	370	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam17389	Bac_rhamnosid6H	5.61e-06	534	627	166	255	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
TIGR01577	oligosac_amyl	0.001	539	636	415	526	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.
cd02861	E_set_pullulanase_like	0.006	159	227	7	76	Early set domain associated with the catalytic domain of pullulanase-like proteins. E or "early" set domains are associated with the catalytic domain of pullulanase at either the N-terminal or C-terminal end, and in a few instances at both ends. Pullulanase (also called dextrinase or alpha-dextrin endo-1,6-alpha glucosidase) is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. The E set domain of pullulanase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, isoamylase, and the beta subunit of AMP-activated protein kinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBQ36601.1	1.47e-242	309	1099	50	814
QCP11581.1	1.38e-236	294	1103	32	830
AVR98316.1	3.75e-228	308	1099	46	811
AKT39344.1	3.28e-182	299	1099	95	891
APR83945.1	1.34e-175	293	1103	88	903

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000039	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001691_02073.