CAZyme Information: MGYG000001691_02189

Basic Information

• Species: Aeromonas veronii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii_A
• CAZyme ID: MGYG000001691_02189
• CAZy Family: GT2
• CAZyme Description: UDP-N-acetylgalactosamine-undecaprenyl-phosphate N-acetylgalactosaminephosphotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		48886.48	9.6399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001691	4542842	Isolate	not provided	not provided

• Gene Location: Start: 283131; End: 284402 Strand: +

Full Sequence      

MSYQRRHSRWYERIIFTPPALFILGALLTVCLPAIERWGWEFWYQMDAVRINTLSGAFVA
FLLTGIVLHRFLRYPGASPVAYMIPTVTTLYGALVGVLFFLRLPYSRQVLFESYMVALLC
CWLAYFIGRRYRTPKYALLPFGDYLALTRHACVEWRLLDKPDLGAVRYDAVVADLRDEKL
AGEWERFLARCALAHIPVYHIKQISETLTGRVKIDHLHENQLGSLLPSPVYAFIKRGMDI
LAALIAIPLFSPLMLVTAILIKLESPGPVMFLQNRVGKGNKDFCIYKFRSMCQNSEQHGA
QFAQDGDMRVTRVGKVIRKLRIDELPQFFNVLKGDMSLIGPRPEQRTFVDQFEREIPFYM
YRHIVRPGISGWAQVVHGYAADADDTRIKIEHDFYYIKHFSLWLDVLIVFKTIRTILTGF
GAR

Enzyme Prediction     

No EC number prediction in MGYG000001691_02189.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03025	EPS_sugtrans	6.35e-111	24	423	4	445	exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase. Members of this family are generally found near other genes involved in the biosynthesis of a variety of exopolysaccharides. These proteins consist of two fused domains, an N-terminal hydrophobic domain of generally low conservation and a highly conserved C-terminal sugar transferase domain (pfam02397). Characterized and partially characterized members of this subfamily include Salmonella WbaP (originally RfbP), E. coli WcaJ, Methylobacillus EpsB, Xanthomonas GumD, Vibrio CpsA, Erwinia AmsG, Group B Streptococcus CpsE (originally CpsD), and Streptococcus suis Cps2E. Each of these is believed to act in transferring the sugar from, for instance, UDP-glucose or UDP-galactose, to a lipid carrier such as undecaprenyl phosphate as the first (priming) step in the synthesis of an oligosaccharide "block". This function is encoded in the C-terminal domain. The liposaccharide is believed to be subsequently transferred through a "flippase" function from the cytoplasmic to the periplasmic face of the inner membrane by the N-terminal domain. Certain closely related transferase enzymes, such as Sinorhizobium ExoY and Lactococcus EpsD, lack the N-terminal domain and are not found by this model.
pfam02397	Bac_transf	1.18e-90	235	418	1	181	Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.
TIGR03023	WcaJ_sugtrans	3.70e-87	20	419	4	446	Undecaprenyl-phosphate glucose phosphotransferase. This family of proteins encompasses the E. coli WcaJ protein involved in colanic acid biosynthesis, the Methylobacillus EpsB protein involved in methanolan biosynthesis, as well as the GumD protein involved in the biosynthesis of xanthan. All of these are closely related to the well-characterized WbaP (formerly RfbP) protein, which is the first enzyme in O-antigen biosynthesis in Salmonella typhimurium. The enzyme transfers galactose from UDP-galactose (NOTE: not glucose) to a polyprenyl carrier (utilizing the highly conserved C-terminal sugar transferase domain, pfam02397) a reaction which takes place at the cytoplasmic face of the inner membrane. The N-terminal hydrophobic domain is then believed to facilitate the "flippase" function of transferring the liposaccharide unit from the cytoplasmic face to the periplasmic face of the inner membrane. Most of these genes are found within large operons dedicated to the production of complex exopolysaccharides such as the enterobacterial O-antigen. Colanic acid biosynthesis utilizes a glucose-undecaprenyl carrier, knockout of EpsB abolishes incorporation of UDP-glucose into the lipid phase, and the C-terminal portion of GumD has been shown to be responsible for the glucosyl-1-transferase activity.
TIGR03013	EpsB_2	3.44e-83	188	421	206	442	sugar transferase, PEP-CTERM system associated. Members of this protein family belong to the family of bacterial sugar transferases (pfam02397). Nearly all are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria (notable exceptions appear to include Magnetococcus sp. MC-1 and Myxococcus xanthus DK 1622 ). These genes are generally found near one or more of the PrsK, PrsR or PrsT genes that have been related to the PEP-CTERM system by phylogenetic profiling methods. The nature of the sugar transferase reaction catalyzed by members of this clade is unknown and may conceivably be variable with respect to substrate by species. These proteins are homologs of the EpsB protein found in Methylobacillus sp. strain 12S, which is also associated with a PEP-CTERM system, but of a distinct type. A name which appears attached to a number of genes (by transitive annotation) in this family is "undecaprenyl-phosphate galactose phosphotransferase", which comes from relatively distant characterized enterobacterial homologs, and is considerably more specific than warranted from the currently available evidence.
COG2148	WcaJ	1.32e-78	225	422	31	225	Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWW69811.1	2.70e-166	4	423	110	527
ALK88913.1	1.60e-74	52	423	424	817
ATD00364.1	1.54e-48	232	421	396	596
AIY66659.1	7.87e-48	232	421	396	596
QWV05914.1	1.02e-43	230	421	400	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W7L_A	7.69e-35	233	421	9	189	Structureof Campylobacter concisus PglC I57M/Q175M variant [Campylobacter concisus 13826],5W7L_B Structure of Campylobacter concisus PglC I57M/Q175M variant [Campylobacter concisus 13826]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3FN88	2.04e-297	1	423	1	423	UDP-N-acetylgalactosamine-undecaprenyl-phosphate N-acetylgalactosaminephosphotransferase OS=Aeromonas hydrophila OX=644 GN=wecA PE=1 SV=2
Q9ABR0	5.59e-44	223	418	65	262	UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=pssY PE=1 SV=1
O32274	3.07e-40	231	362	30	161	Putative undecaprenyl-phosphate N-acetylgalactosaminyl 1-phosphate transferase OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaA PE=2 SV=1
P71241	3.11e-39	228	413	267	454	UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase OS=Escherichia coli (strain K12) OX=83333 GN=wcaJ PE=1 SV=2
Q56770	4.26e-39	210	412	271	473	UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase OS=Xanthomonas campestris pv. campestris OX=340 GN=gumD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35
50	72
79	101
111	128
240	261