CAZyme Information: MGYG000001691_02496

Basic Information

• Species: Aeromonas veronii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii_A
• CAZyme ID: MGYG000001691_02496
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
239	MGYG000001691_20|CGC1	28339.31	7.8103

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001691	4542842	Isolate	not provided	not provided

• Gene Location: Start: 32007; End: 32726 Strand: +

Full Sequence      

MQAFYMYPCLYLTKEETERFDGDFQGCLESFLRGENHRVEGIALASSCLLMNREWFLQLG
GFDEQFVGHGGEDLELIDRLTRHYPIGPRPDDYALNIKAQHPGDYQGFRRYFSYYALPHL
FAGRFLVHQWHPRPLTHPYHKRRANNDQLLEQMLARSEAERGPLKGPVVPCDDLGGELPE
FREWMIRLQEEAGYPVSEYPGLLRWQEGVQRKRPLWRKLRKLYLNPRAFFRDMFKPTSR

Enzyme Prediction     

No EC number prediction in MGYG000001691_02496.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	2	152	1.2e-22	0.5652173913043478

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4092	COG4092	1.42e-19	1	154	128	290	Predicted glycosyltransferase involved in capsule biosynthesis [Cell wall/membrane/envelope biogenesis].
pfam10111	Glyco_tranf_2_2	1.66e-19	2	149	116	269	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06420	GT2_Chondriotin_Pol_N	3.18e-05	53	82	135	164	N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase. Chondroitin polymerase is a two domain, bi-functional protein. The N-terminal domain functions as a GalNAc transferase. The bacterial chondroitin polymerase catalyzes elongation of the chondroitin chain by alternatively transferring the GlcUA and GalNAc moiety from UDP-GlcUA and UDP-GalNAc to the non-reducing ends of the chondroitin chain. The enzyme consists of N-terminal and C-terminal domains in which the two active sites catalyze the addition of GalNAc and GlcUA, respectively. Chondroitin chains range from 40 to over 100 repeating units of the disaccharide. Sulfated chondroitins are involved in the regulation of various biological functions such as central nervous system development, wound repair, infection, growth factor signaling, and morphogenesis, in addition to its conventional structural roles. In Caenorhabditis elegans, chondroitin is an essential factor for the worm to undergo cytokinesis and cell division. Chondroitin is synthesized as proteoglycans, sulfated and secreted to the cell surface or extracellular matrix.
pfam02709	Glyco_transf_7C	3.64e-05	49	83	24	58	N-terminal domain of galactosyltransferase. This is the N-terminal domain of a family of galactosyltransferases from a wide range of Metazoa with three related galactosyltransferases activities, all three of which are possessed by one sequence in some cases. EC:2.4.1.90, N-acetyllactosamine synthase; EC:2.4.1.38, Beta-N-acetylglucosaminyl-glycopeptide beta-1,4- galactosyltransferase; and EC:2.4.1.22 Lactose synthase. Note that N-acetyllactosamine synthase is a component of Lactose synthase along with alpha-lactalbumin, in the absence of alpha-lactalbumin EC:2.4.1.90 is the catalyzed reaction.
cd02510	pp-GalNAc-T	5.43e-05	43	76	170	203	pp-GalNAc-T initiates the formation of mucin-type O-linked glycans. UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferases (pp-GalNAc-T) initiate the formation of mucin-type, O-linked glycans by catalyzing the transfer of alpha-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to hydroxyl groups of Ser or Thr residues of core proteins to form the Tn antigen (GalNAc-a-1-O-Ser/Thr). These enzymes are type II membrane proteins with a GT-A type catalytic domain and a lectin domain located on the lumen side of the Golgi apparatus. In human, there are 15 isozymes of pp-GalNAc-Ts, representing the largest of all glycosyltransferase families. Each isozyme has unique but partially redundant substrate specificity for glycosylation sites on acceptor proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSR45780.1	1.41e-175	3	239	46	282
AHV35627.1	2.01e-175	6	239	1	234
AXV34919.1	5.76e-175	6	239	1	234
AAM22575.1	1.93e-173	4	239	125	360
QSR70786.1	1.43e-172	3	239	53	289

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001691_02496.