CAZyme Information: MGYG000001691_02822

Basic Information

• Species: Aeromonas veronii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii_A
• CAZyme ID: MGYG000001691_02822
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487		53841.63	6.388

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001691	4542842	Isolate	not provided	not provided

• Gene Location: Start: 434194; End: 435657 Strand: +

Full Sequence      

MFKPKRCAWLIAAACTLPSYAVISATMNIQPDPQNAGGYVIAAPDLAAVEKAKTANPMYA
IWAKALATRSNKIVDAIEPGLANNPDNVKRVERVFPQSEWEYLTQMAAPEYTYVRFLRAI
GKFPAFCGEYTDGRDSDAICKKSIVTAFAHFSQETGGHIAKENVSDNPLGLEEWQQALVH
VREMGWSEGQTGYTTGCGQNDWQNKKWPCSTGQGYFGRGAKQLSYHFNYGAFSEAMFDGD
ASVLLNNPGLVADSWLNLASAIWFFLTPQAPKPAMLHVIDRTWVPSKREVDAGIGYGFGT
TINVINGGIECGEQNKDKGQPVNRIRYWEGLANHYQIPIKADEKNTCWQQTPYGSLNLNG
ATDVLYTNWDGNWKYYPDRPGGYSFECELVGFQTAYSALVPGDYEKCVTNFYGSHANWPK
VRIVAKLDPAPVDPVDPPLDGQPAWEASKVYTAGNKVSYKGAVYQAKWWTQGDEPAKGGP
WAVVVTK

Enzyme Prediction     

EC	3.2.1.14	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	87	347	1e-67	0.9956709956709957
CBM5	443	481	3.7e-17	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00325	chitinase_GH19	1.94e-62	95	347	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
COG3979	COG3979	3.00e-33	28	230	1	181	Chitodextrinase [Carbohydrate transport and metabolism].
pfam00182	Glyco_hydro_19	1.69e-32	111	328	25	215	Chitinase class I.
cd12215	ChiC_BD	1.27e-14	443	481	1	40	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.
smart00495	ChtBD3	5.34e-12	443	481	2	41	Chitin-binding domain type 3.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSR47831.1	0.0	1	487	1	487
BBT95268.1	0.0	1	487	1	487
BBR39812.1	0.0	1	487	1	487
BBU04664.1	0.0	1	487	1	487
QHC08138.1	0.0	1	487	1	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V91_A	3.63e-30	111	355	29	244	ChainA, GH19 Chitinase [Ficus microcarpa],7V91_B Chain B, GH19 Chitinase [Ficus microcarpa],7V91_C Chain C, GH19 Chitinase [Ficus microcarpa],7V91_D Chain D, GH19 Chitinase [Ficus microcarpa]
4TX7_A	9.52e-30	111	354	32	245	Crystalstructure of chitinase (GH19) from Vigna unguiculata [Vigna unguiculata subsp. sesquipedalis]
7V92_A	3.44e-29	111	355	29	244	ChainA, GH19 Chitinase [Ficus microcarpa],7V92_B Chain B, GH19 Chitinase [Ficus microcarpa],7V92_C Chain C, GH19 Chitinase [Ficus microcarpa],7V92_D Chain D, GH19 Chitinase [Ficus microcarpa]
4MST_A	2.18e-28	111	354	26	240	CrystalStructure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis],4MST_B Crystal Structure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis]
2DKV_A	1.26e-27	111	363	85	308	Crystalstructure of class I chitinase from Oryza sativa L. japonica [Oryza sativa Japonica Group],3IWR_A Crystal structure of class I chitinase from Oryza sativa L. japonica [Oryza sativa Japonica Group],3IWR_B Crystal structure of class I chitinase from Oryza sativa L. japonica [Oryza sativa Japonica Group]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P52404	1.91e-29	111	355	94	309	Endochitinase 2 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB2 PE=2 SV=1
P25765	2.33e-29	111	355	108	326	Chitinase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht12 PE=2 SV=2
P24626	2.85e-29	111	353	103	317	Chitinase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht3 PE=2 SV=2
P52405	7.10e-29	111	355	96	311	Endochitinase 3 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB3 PE=2 SV=1
P51613	1.24e-28	111	355	92	307	Basic endochitinase OS=Vitis vinifera OX=29760 GN=CHIT1B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.072903	0.792542	0.132704	0.000914	0.000442	0.000457

TMHMM  Annotations     

start	end
7	29