CAZyme Information: MGYG000001691_03023

Basic Information

• Species: Aeromonas veronii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii_A
• CAZyme ID: MGYG000001691_03023
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263		29833.23	9.925

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001691	4542842	Isolate	not provided	not provided

• Gene Location: Start: 666593; End: 667384 Strand: +

Full Sequence      

MAAPIIPDPDDPSHYQWESGPDAVAPERPSASFGRRVLRWVGKIALAGLLCSVGSVALLR
FIDPPMWSWRIERALFPPAKITQVRHEWVDLESISKELQLAVIAAEDQRFADHNGFDMDA
INAALKHNQHSERVRGASTLSQQTAKNLFMWSDRSFLRKGLEAWFTLLMELGWDKARILE
VYLNIVEFGPGIYGAEAAARTYFGKPASRLTRYESSLLAAALPNPWRYRVKPPSPYVQKR
SVWIRRQMGQLGQITLNRVHQAD

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	80	248	7.5e-55	0.9548022598870056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	2.02e-125	35	260	6	235	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	8.54e-89	39	252	1	222	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	3.74e-72	33	262	7	254	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	3.89e-68	79	248	6	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	4.40e-46	85	255	1	172	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLH66722.1	9.11e-192	1	263	1	263
AEB49855.1	9.11e-192	1	263	1	263
ANB51629.1	1.84e-191	1	263	1	263
QMS78368.1	1.84e-191	1	263	1	263
BBT95490.1	1.84e-191	1	263	1	263

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	2.09e-26	88	262	22	197	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	4.10e-26	88	262	22	197	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	6.01e-21	83	262	36	216	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5FGZ_A	7.98e-21	102	245	172	321	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	8.06e-21	102	245	193	342	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KK53	9.97e-147	32	263	4	235	Biosynthetic peptidoglycan transglycosylase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mtgA PE=3 SV=1
Q8EB02	9.13e-124	35	263	5	233	Biosynthetic peptidoglycan transglycosylase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=mtgA PE=3 SV=2
A1S3J2	1.24e-88	39	256	24	241	Biosynthetic peptidoglycan transglycosylase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=mtgA PE=3 SV=1
B0RQA5	1.46e-72	35	252	18	238	Biosynthetic peptidoglycan transglycosylase OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=mtgA PE=3 SV=1
Q4UXB0	1.46e-72	35	252	18	238	Biosynthetic peptidoglycan transglycosylase OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000003	0.000024	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001691_03023.