CAZyme Information: MGYG000001691_04128

Basic Information

• Species: Aeromonas veronii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii_A
• CAZyme ID: MGYG000001691_04128
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
877	MGYG000001691_24|CGC8	96780.33	6.5158

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001691	4542842	Isolate	not provided	not provided

• Gene Location: Start: 743451; End: 746084 Strand: -

Full Sequence      

MTKMKIVYPMQLAGENGSSEIASLDEFIKKINGLKSGTFPIGRNRIWHGGIHFSKSGGWH
PSGAVRAIADGEIVAYRLATKPAKATRSTEEGKPEGKIDLYTSPSFCLVRHRYEAGEQNK
NRLTFYSLYMHIACENSYNSSEAARVMVKGTGVSTYKPVVEGTPPKLIRRLSGDKPVYAK
RGAEVKLVGQEVKNLLNHKDEPHDYYLVHYVDDPDSLFHIAASQLQQEFPQKPTWMTPPE
GKPARHKVPGNTWLRKSADTTAESLGLPAGSEVVISGEPAQMISINGGTTEFRKVQVFKV
GSGTVKDSANQVMTNASKGAVGWLAKSKMGAGLTAEPSIPVEFKDDAVVDRSANPIPVQA
GEIIGHWGEHELATAGASGFEKDADSKAVHFEVFVAESDKQVLEDCINNKARVTGGQGYL
LVKKKVTTYRLTSDSKHGFHEVANFGPLVLPLAVKESDIVTHGANNFVKVRERTAADGEL
AGEFVLQGGDVEVISQHDWHKLGVKLVDGSSDDDGFLDKADTESEEPQQKEASKFFSTLY
DKLVTDGDNDGTLSGNDIKAALADEELAGKLRMLFIKHKSEWVKPGDWPRLKQELAEQPK
LYEYAMQVHNNMAWMEDASAILGDTKPWFIHPAGMMGLVAEPISDDEMDEKWLTVPKGQL
TFDAEGNDVDTSIYFSRKPHIPMQRDGTVIGQSGITYGRGLDIGQQTQPFVSNLLSAISE
NARPLSDKMSSWLIVGSGKKRDLAKDHLALINDSVPMDEQILTRKQQHFLFLSVYGDRES
TTKRTIEAARGSRHVLAPPGKIIWDQLPTDVKEVLVDLTFRGDNHSKSRDSIIPTLVEGL
ESGDYSAFKYLMSDRSVWIDVFRVPRERFNARSSWVN

Enzyme Prediction     

No EC number prediction in MGYG000001691_04128.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16903	pesticin_lyz-like	1.21e-57	653	821	1	150	pesticin C-terminal-like domain of uncharacterized proteins. This subfamily is composed of uncharacterized proteins containing a lysozyme-like domain similar to the C-terminal domain of pesticin. Some members also contain an EF hand domain. Pesticin (Pst) is an anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. Pst contains an N-terminal translocation domain, an intermediate receptor binding domain, and a phage-lysozyme like C-terminal activity domain. Bacteriocins such as pesticin are produced by gram-negative bacteria to attack related bacterial stains. Pst is transported to the periplasm via FyuA, an outer-membrane receptor of Y. pestis and E. coli, where it hydrolyzes peptidoglycan via the cleavage of N-acetylmuramic acid and C4 of N-acetylglucosamine. Disruption of the peptidoglycan layer renders the bacteria vulnerable to lysis via osmotic pressure. The pesticin C-terminal domain resembles the lysozyme-like family, which includes soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides.
cd12799	pesticin_lyz-like	1.27e-09	666	821	1	129	lysozyme-like C-terminal domain of pesticin and related proteins. Pesticin (Pst) is an anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. Pst contains an N-terminal translocation domain, an intermediate receptor binding domain, and a phage-lysozyme like C-terminal activity domain. Bacteriocins such as pesticin are produced by gram-negative bacteria to attack related bacterial stains. Pst is transported to the periplasm via FyuA, an outer-membrane receptor of Y. pestis and E. coli, where it hydrolyzes peptidoglycan via the cleavage of N-acetylmuramic acid and C4 of N-acetylglucosamine. Disruption of the peptidoglycan layer renders the bacteria vulnerable to lysis via osmotic pressure. The pesticin C-terminal domain resembles the lysozyme-like family, which includes soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides.
cd16902	pesticin_lyz	8.96e-06	675	827	13	139	lysozyme-like C-terminal domain of pesticin. Pesticin (Pst) is an anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. Pst contains an N-terminal translocation domain, an intermediate receptor binding domain, and a phage-lysozyme like C-terminal activity domain. Bacteriocins such as pesticin are produced by gram-negative bacteria to attack related bacterial stains. Pst is transported to the periplasm via FyuA, an outer-membrane receptor of Y. pestis and E. coli, where it hydrolyzes peptidoglycan via the cleavage of N-acetylmuramic acid and C4 of N-acetylglucosamine. Disruption of the peptidoglycan layer renders the bacteria vulnerable to lysis via osmotic pressure. The pesticin C-terminal domain resembles the lysozyme-like family, which includes soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSR74883.1	0.0	31	641	1	612
AKA17725.1	0.0	4	649	1	645
SBT60307.1	1.11e-285	4	641	1	633
AVQ87085.1	1.05e-276	4	639	1	631
QOH80403.1	2.00e-276	4	640	1	632

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001691_04128.